DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and CSTF2T

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_056050.1 Gene:CSTF2T / 23283 HGNCID:17086 Length:616 Species:Homo sapiens


Alignment Length:171 Identity:42/171 - (24%)
Similarity:69/171 - (40%) Gaps:24/171 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDR-AGVSKGYGFVTFETEQEAQRLQADGECVVL 98
            :|||.|..:.||..|..:||..|:|.|.:::.|| .|..|||||..::.::.|.....:......
Human    18 VFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREF 82

  Fly    99 RDRKLNI-APAIKKQPNPLQSIVATNGAVYYTTTPPAPISNIPMDQFAAAVYPPVTDFTAAGVPA 162
            ..|.|.: ..|.:|....|:|:           .|.|||.:.|   :...:.|.....:.....|
Human    83 SGRALRVDNAASEKNKEELKSL-----------GPAAPIIDSP---YGDPIDPEDAPESITRAVA 133

  Fly   163 IYPPSAMQYQPFYQYYSVPMNVPTIWPQNYQENHSPLLHSP 203
            ..||.        |.:.:...:......::||..:.||.:|
Human   134 SLPPE--------QMFELMKQMKLCVQNSHQEARNMLLQNP 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 24/77 (31%)
PABP-1234 <45..219 CDD:130689 38/161 (24%)
CSTF2TNP_056050.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 23/75 (31%)
CSTF2_hinge 112..191 CDD:433869 11/66 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..241
PRK12323 <242..>387 CDD:481241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..418
9 X 5 AA tandem repeats of M-E-T-R-[AG] 418..462
9 X 5 AA tandem repeats of G-[AT]-G-[MI]-Q 505..549
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 542..573
CSTF_C 572..612 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.