DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and sart-3

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_502136.1 Gene:sart-3 / 178053 WormBaseID:WBGene00007111 Length:836 Species:Caenorhabditis elegans


Alignment Length:86 Identity:32/86 - (37%)
Similarity:52/86 - (60%) Gaps:3/86 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKGYGFVTFETEQEAQRLQADG 93
            ||..:::||..:....|:.:|..:||.:|||.|.:.:..:.|..||..||.|:||..||:..|.|
 Worm   679 TLEKSKVFVRNVHFQATDDELKALFSKFGTVTSVRRVTHKDGKPKGIAFVDFDTEASAQKCVASG 743

  Fly    94 ECVVLRDRKLNIA---PAIKK 111
            :.::||:|:|.:|   |.:||
 Worm   744 DKLMLRERELEVALSNPPVKK 764

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 28/82 (34%)
PABP-1234 <45..219 CDD:130689 28/70 (40%)
sart-3NP_502136.1 RRM_SF 594..664 CDD:473069
RRM_SF 681..761 CDD:473069 27/79 (34%)
Lsm_interact 818..835 CDD:398843
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.