DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and rnp-7

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_498565.2 Gene:rnp-7 / 176002 WormBaseID:WBGene00004390 Length:332 Species:Caenorhabditis elegans


Alignment Length:88 Identity:30/88 - (34%)
Similarity:47/88 - (53%) Gaps:13/88 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ETPLAA-PKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKGYGFVTFET 82
            |.|.|: ..|.||     |||.|:.:|:|:.|.|.|.|||.:|...::.|.||..:||.|:.:..
 Worm    94 ENPRASEDPYRTL-----FVGRINYETSESKLRREFEAYGKIKKLTMVHDEAGKPRGYAFIEYSD 153

  Fly    83 EQE-------AQRLQADGECVVL 98
            :.|       |..::.||:.:|:
 Worm   154 KAEMHTAYKKADGIKVDGKRLVV 176

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 24/75 (32%)
PABP-1234 <45..219 CDD:130689 19/61 (31%)