DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and tiar-2

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_496718.1 Gene:tiar-2 / 174909 WormBaseID:WBGene00012904 Length:434 Species:Caenorhabditis elegans


Alignment Length:89 Identity:26/89 - (29%)
Similarity:37/89 - (41%) Gaps:9/89 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHKIAAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKII 65
            ||...|..|  ..||.....|..:..:      .:|||.:..:.....|...|..:|.|...|||
 Worm   108 MHVTWAFEP--REPGENRSKPETSRHF------HVFVGDLCSEIDSTKLREAFVKFGEVSEAKII 164

  Fly    66 VD-RAGVSKGYGFVTFETEQEAQR 88
            .| .....||||||::...::|:|
 Worm   165 RDNNTNKGKGYGFVSYPRREDAER 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 19/59 (32%)
PABP-1234 <45..219 CDD:130689 16/45 (36%)
tiar-2NP_496718.1 PABP-1234 41..>317 CDD:130689 26/89 (29%)
RRM_SF 133..207 CDD:473069 19/56 (34%)
RRM3_TIA1_like 256..325 CDD:409790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.