DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and daz-1

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_495036.3 Gene:daz-1 / 173931 WormBaseID:WBGene00000935 Length:498 Species:Caenorhabditis elegans


Alignment Length:221 Identity:75/221 - (33%)
Similarity:100/221 - (45%) Gaps:42/221 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HKIAAAPPPSAT----------PGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAY 56
            |::.:..|.:.|          |.|......|.|.| .||||||||||....|||.:|...|..:
 Worm    26 HQMVSFMPQTPTSLPSTPIQLYPTGAAALIPAPPTY-ELIPNRIFVGGFPTSTTETELREHFEKF 89

  Fly    57 GTVKSTKIIVDRAGVSKGYGFVTFETEQEAQRL-QADGECVVLRDRKLNIAPAIKK------QPN 114
            ..||..|::....|.||||||:|||||.:|:.: :...:.:..|.||||:.|||:|      ||:
 Worm    90 FAVKDVKMVKSLDGQSKGYGFITFETEDQAEEIRKLTPKQLEFRSRKLNLGPAIRKINSNSFQPS 154

  Fly   115 -----PLQSIVATNGAVYYTTTPPAPISNIPMDQFAAAVYPPVTDFTAAGVPAIYPPSAMQYQPF 174
                 |.|.:.|:.|...|.    .|.|..|...::   ||      |:....:|||...|.|..
 Worm   155 YAIATPSQLVAASPGPFSYA----IPASPSPYSGYS---YP------ASPQMFVYPPLRSQDQSR 206

  Fly   175 YQ--YYSVPMNVPTIWPQNYQENHSP 198
            .|  ..:.|.|.||    |.|...||
 Worm   207 QQSEQQTTPQNSPT----NLQHQQSP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 38/80 (48%)
daz-1NP_495036.3 RRM <56..>150 CDD:223796 43/94 (46%)
RRM_DAZL_BOULE 64..145 CDD:240858 38/80 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159138
Domainoid 1 1.000 56 1.000 Domainoid score I7341
eggNOG 1 0.900 - - E33208_3BEMJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1610446at2759
OrthoFinder 1 1.000 - - FOG0002544
OrthoInspector 1 1.000 - - oto17611
orthoMCL 1 0.900 - - OOG6_107966
Panther 1 1.100 - - O PTHR11176
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2474
SonicParanoid 1 1.000 - - X491
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.