DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and Rbm39

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_573505.2 Gene:Rbm39 / 170791 MGIID:2157953 Length:530 Species:Mus musculus


Alignment Length:78 Identity:26/78 - (33%)
Similarity:42/78 - (53%) Gaps:11/78 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYGFVTFETEQEAQRLQA 91
            |:..|.|::||.:..:.||..|..:|..:|.::|.::::| ..|.||||||:||          :
Mouse   245 GSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITF----------S 299

  Fly    92 DGECVVLRDRKLN 104
            |.||......:||
Mouse   300 DSECAKKALEQLN 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 25/75 (33%)
PABP-1234 <45..219 CDD:130689 21/61 (34%)
Rbm39NP_573505.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..146
SF-CC1 46..518 CDD:273721 26/78 (33%)
Interaction with JUN. /evidence=ECO:0000269|PubMed:11704680 291..406 12/32 (38%)
Activating domain 291..355 12/32 (38%)
Interaction with ESR1 and ESR2. /evidence=ECO:0000269|PubMed:11704680 355..406
Interaction with NCOA6. /evidence=ECO:0000269|PubMed:11704680 406..530
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.