DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and DAZL

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001177740.1 Gene:DAZL / 1618 HGNCID:2685 Length:315 Species:Homo sapiens


Alignment Length:222 Identity:66/222 - (29%)
Similarity:91/222 - (40%) Gaps:65/222 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRA 69
            |:....||....|...|     .|.::||.:|||||.....|.::...|:.||:||..|||.||.
Human    37 ASTQSSSAATSQGYILP-----EGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRT 96

  Fly    70 GVSKGYGFVTFETEQEAQRLQADGECVVLRDRKLNIAPAIKK--------QPNPLQSIVATNGAV 126
            |||||||||:|..:.:.|::....  :....:||.:.|||:|        ||.||          
Human    97 GVSKGYGFVSFFNDVDVQKIVESQ--INFHGKKLKLGPAIRKQNLCAYHVQPRPL---------- 149

  Fly   127 YYTTTPPAPISNI-----------------PMDQFAAAVYPPVTDFTAAGVPAIYPPSAMQ---- 170
            .:...||....|:                 |:.|:..| ||            .||.|.:|    
Human   150 VFNHPPPPQFQNVWTNPNTETYMQPTTTMNPITQYVQA-YP------------TYPNSPVQVITG 201

  Fly   171 YQ-PFYQYYSVPMNVPTIWPQNYQENH 196
            || |.|.|     .:|..||...|.::
Human   202 YQLPVYNY-----QMPPQWPVGEQRSY 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 34/79 (43%)
DAZLNP_001177740.1 RRM_DAZL 55..136 CDD:241116 35/82 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146924
Domainoid 1 1.000 77 1.000 Domainoid score I8875
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1610446at2759
OrthoFinder 1 1.000 - - FOG0002544
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11176
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2474
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.940

Return to query results.
Submit another query.