DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and DAZ1

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_004072.3 Gene:DAZ1 / 1617 HGNCID:2682 Length:744 Species:Homo sapiens


Alignment Length:282 Identity:76/282 - (26%)
Similarity:103/282 - (36%) Gaps:94/282 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRA 69
            |:....||....|...|     .|.::||.:|||||.....|.::...|..||:||..|||.:|.
Human   347 ASTQSSSAAASQGWVLP-----EGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRT 406

  Fly    70 GVSKGYGFVTFETEQEAQRLQADGECVVLRDRKLNIAPAIKK--------QPNPLQSIVATNGAV 126
            |||||||||:|..:.:.|::.  |..:....:||.:.|||:|        ||.||          
Human   407 GVSKGYGFVSFVNDVDVQKIV--GSQIHFHGKKLKLGPAIRKQKLCARHVQPRPL---------- 459

  Fly   127 YYTTTPPAP-------------------ISNIPMDQF--AAAVYPPVTDFTAAGVPAI------- 163
              ...||.|                   |:..|:.|.  |.:.||........|...:       
Human   460 --VVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVITGCQLLVYNYQEY 522

  Fly   164 --YPPSAMQ-----------YQPFYQYYSVPMNVPTIWP---QNYQENHSPLLHSPTSNPHSPHS 212
              ||.||.|           ||||..|...|..|...:.   .|||        :..:.|:||..
Human   523 PTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTAGYQLPVYNYQ--------AFPAYPNSPFQ 579

  Fly   213 ---------------QSHPQSP 219
                           .::|.||
Human   580 VATGYQFPVYNYQPFPAYPSSP 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 34/79 (43%)
DAZ1NP_004072.3 RRM_DAZL 35..116 CDD:241116
PABP-1234 42..603 CDD:130689 76/282 (27%)
RRM_DAZL 200..281 CDD:241116
RRM_DAZL 365..446 CDD:241116 35/82 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146926
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1610446at2759
OrthoFinder 1 1.000 - - FOG0002544
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11176
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.