DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and HNRNPA1L2

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001011724.1 Gene:HNRNPA1L2 / 144983 HGNCID:27067 Length:320 Species:Homo sapiens


Alignment Length:88 Identity:28/88 - (31%)
Similarity:40/88 - (45%) Gaps:13/88 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KIAAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD 67
            |.|.:...|..||..|..            .:||||||..||.|..|...|..||.::..:|:.|
Human    87 KRAVSREDSQRPGAHLTV------------KKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTD 139

  Fly    68 R-AGVSKGYGFVTFETEQEAQRL 89
            | :|..:|:.||||:......::
Human   140 RGSGKKRGFAFVTFDDHDSVDKI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 22/60 (37%)
HNRNPA1L2NP_001011724.1 Globular A domain 4..94 2/6 (33%)
RRM1_hnRNPA1 12..92 CDD:410154 2/4 (50%)
Globular B domain 95..185 26/80 (33%)
RRM_SF 105..184 CDD:418427 22/58 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..216
RNA-binding RGG-box 218..240
HnRNPA1 255..292 CDD:402981
Nuclear targeting sequence. /evidence=ECO:0000250 268..305
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.