DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and Dazl

DIOPT Version :9

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_006523646.1 Gene:Dazl / 13164 MGIID:1342328 Length:408 Species:Mus musculus


Alignment Length:250 Identity:78/250 - (31%)
Similarity:108/250 - (43%) Gaps:62/250 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRA 69
            |:....|||...|...|     .|.::||.:|||||.....|.::...|:.||:||..|||.||.
Mouse   127 ASTQSSSATTSQGYVLP-----EGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRT 186

  Fly    70 GVSKGYGFVTFETEQEAQRLQADGECVVLRDRKLNIAPAIKK--------QPNPL---------- 116
            |||||||||:|..:.:.|::....  :....:||.:.|||:|        ||.||          
Mouse   187 GVSKGYGFVSFYNDVDVQKIVESQ--INFHGKKLKLGPAIRKQNLCTYHVQPRPLIFNPPPPPQF 249

  Fly   117 QSIVATNGAVYYTTTPPAPISNIPMDQFAAAVYPPVTDFTAAGVPAIYPPSAMQ----YQ-PFYQ 176
            ||:.::..|..| ..||..::  |:.|:..| |||            ||.|.:|    || |.|.
Mouse   250 QSVWSSPNAETY-MQPPTMMN--PITQYVQA-YPP------------YPSSPVQVITGYQLPVYN 298

  Fly   177 YYSVPMNVPTIWPQNYQENHSPLLHSPTSNPHSPHSQSHPQSPCWSIEDLRDTLP 231
            |     .:|..||...|.::.......|.|.|           |..::...|.||
Mouse   299 Y-----QMPPQWPAGEQRSYVIPPAYTTVNYH-----------CSEVDPGADILP 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:240858 34/79 (43%)
DazlXP_006523646.1 RRM_DAZL 145..226 CDD:241116 35/82 (43%)
PABP-1234 <150..318 CDD:130689 63/190 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836871
Domainoid 1 1.000 76 1.000 Domainoid score I8951
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1610446at2759
OrthoFinder 1 1.000 - - FOG0002544
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11176
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2474
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.940

Return to query results.
Submit another query.