powered by:
Protein Alignment bol and Hnrnpd
DIOPT Version :9
Sequence 1: | NP_001261614.1 |
Gene: | bol / 39049 |
FlyBaseID: | FBgn0011206 |
Length: | 233 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001070733.1 |
Gene: | Hnrnpd / 11991 |
MGIID: | 101947 |
Length: | 355 |
Species: | Mus musculus |
Alignment Length: | 89 |
Identity: | 29/89 - (32%) |
Similarity: | 47/89 - (52%) |
Gaps: | 15/89 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDR-AGVSKGYGFVTFETEQEAQRLQADGECVV 97
::|:||:|.|||:.||...||.:|.|....:.:|. .|.|:|:|||.|:..:...::...
Mouse 98 KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQ----- 157
Fly 98 LRDRKLN-------IAPAIK-KQP 113
::.||| .|.|:| |:|
Mouse 158 -KEHKLNGKVIDPKRAKAMKTKEP 180
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.