DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and Hnrnpd

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001070733.1 Gene:Hnrnpd / 11991 MGIID:101947 Length:355 Species:Mus musculus


Alignment Length:89 Identity:29/89 - (32%)
Similarity:47/89 - (52%) Gaps:15/89 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDR-AGVSKGYGFVTFETEQEAQRLQADGECVV 97
            ::|:||:|.|||:.||...||.:|.|....:.:|. .|.|:|:|||.|:..:...::...     
Mouse    98 KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQ----- 157

  Fly    98 LRDRKLN-------IAPAIK-KQP 113
             ::.|||       .|.|:| |:|
Mouse   158 -KEHKLNGKVIDPKRAKAMKTKEP 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 27/85 (32%)
PABP-1234 <45..219 CDD:130689 23/78 (29%)
HnrnpdNP_001070733.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91
CBFNT <60..78 CDD:311868
RRM1_hnRNPD 99..172 CDD:410150 24/78 (31%)
RRM2_hnRNPD 183..257 CDD:241027
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.