DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bol and SLIRP2

DIOPT Version :10

Sequence 1:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_003435781.1 Gene:SLIRP2 / 11175582 VectorBaseID:AGAMI1_013466 Length:93 Species:Anopheles gambiae


Alignment Length:76 Identity:28/76 - (36%)
Similarity:43/76 - (56%) Gaps:2/76 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRA-GVSKGYGFVTFETEQEAQRLQADGECVV 97
            ::|||.:....:..:|...||.||.|.||.:|.|:: |:|:||||:.|.| :|......:....|
Mosquito    17 KLFVGNLPWTVSTKELKTYFSKYGHVHSTNVIYDKSTGISRGYGFIVFST-REGFTNATNNRLHV 80

  Fly    98 LRDRKLNIAPA 108
            |..|.|::.||
Mosquito    81 LEGRVLDLQPA 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 28/76 (37%)
PABP-1234 <45..219 CDD:130689 25/65 (38%)
SLIRP2XP_003435781.1 RRM_SF 17..89 CDD:473069 26/72 (36%)

Return to query results.
Submit another query.