Sequence 1: | NP_648288.2 | Gene: | teq / 39048 | FlyBaseID: | FBgn0023479 | Length: | 2792 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097955.1 | Gene: | CG34437 / 5740179 | FlyBaseID: | FBgn0085466 | Length: | 266 | Species: | Drosophila melanogaster |
Alignment Length: | 238 | Identity: | 61/238 - (25%) |
---|---|---|---|
Similarity: | 107/238 - (44%) | Gaps: | 51/238 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 2559 PWQATIRTRGRGGISSHWCGAVVISKRHLLTAAHCLYGSPKGAYFVRVGDHYANIAESSE--VDS 2621
Fly 2622 FIENWYLHENFRKGTHMNNDIALVVLKTPLKFSDYVQPICL---PDKNAELVEDRKCTISGWG-- 2681
Fly 2682 --SIKSGVSTPAQVLGSAELPILADHVCKQSNVYGSAMSEGMFCAGSMDESVDACEGDSGGPLV- 2743
Fly 2744 ---CSDDDGETLYGLISWG--QHCGFKNRPGVYVRVNHYIDWI 2781 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
teq | NP_648288.2 | CBM_14 | 65..115 | CDD:279884 | |
ChtBD2 | 136..184 | CDD:214696 | |||
ChtBD2 | 215..261 | CDD:214696 | |||
ChtBD2 | 284..327 | CDD:214696 | |||
CBM_14 | 521..569 | CDD:279884 | |||
ChtBD2 | 608..654 | CDD:214696 | |||
ChtBD2 | 709..752 | CDD:214696 | |||
CBM_14 | 782..830 | CDD:279884 | |||
ChtBD2 | 864..909 | CDD:214696 | |||
CBM_14 | 942..993 | CDD:279884 | |||
RCR | <1051..1126 | CDD:304939 | |||
RCR | <1116..1210 | CDD:304939 | |||
ChtBD2 | 1324..1369 | CDD:214696 | |||
ChtBD2 | 1474..1518 | CDD:214696 | |||
LDLa | 2193..2222 | CDD:238060 | |||
SR | 2229..2331 | CDD:214555 | |||
SRCR | 2234..2332 | CDD:278931 | |||
LDLa | 2337..2370 | CDD:197566 | |||
SR | 2382..2480 | CDD:214555 | |||
SRCR | 2386..2480 | CDD:278931 | |||
Tryp_SPc | 2546..2781 | CDD:214473 | 59/236 (25%) | ||
Tryp_SPc | 2547..2784 | CDD:238113 | 61/238 (26%) | ||
CG34437 | NP_001097955.1 | Tryp_SPc | 39..242 | CDD:214473 | 59/236 (25%) |
Tryp_SPc | 39..242 | CDD:304450 | 59/236 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24258 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |