DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment teq and bark

DIOPT Version :9

Sequence 1:NP_648288.2 Gene:teq / 39048 FlyBaseID:FBgn0023479 Length:2792 Species:Drosophila melanogaster
Sequence 2:NP_001245864.1 Gene:bark / 33604 FlyBaseID:FBgn0031571 Length:3123 Species:Drosophila melanogaster


Alignment Length:214 Identity:56/214 - (26%)
Similarity:84/214 - (39%) Gaps:41/214 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  2359 DNTPDCADKSDECAAVCQAP-VQYRLEGGRNSNEGRLEVKHHGVWGSVCDDDFNLKSAQVACNSM 2422
            |:..:..|...|.......| |..||.||..:|||||:|...|.||:|||..:|:.:|.:.|:.:
  Fly  1048 DSETEAIDMETEVIPADGVPRVPVRLVGGAGANEGRLQVYLKGRWGTVCDYGWNVLNAALVCHQL 1112

  Fly  2423 GF-FGPA--KIEKNIFGN--SNGPIWLDQVMCFGNETSIDQCNHWNWGEHNCNHTEDVALHCSAG 2482
            |: ..|.  ::.::...|  ::..|.:..|.|...:..:.:|......|:.|:|..||.|.|..|
  Fly  1113 GYSLNPQDWRLLRSQLPNAGTSEDILMANVRCTLQDRDVTKCRAEYEFENTCSHENDVGLRCYEG 1177

  Fly  2483 PPPRSQRYSQTQIKGGRSLGRETTPKTYSQIGLWERSSKAVHTPRRCGIFKDDLT---------- 2537
             .....|:|.                      |.||:.....|..:.|:|  |.|          
  Fly  1178 -AWAGVRFSM----------------------LAERADLQYVTVEKAGLF--DYTTNAFKPAVQM 1217

  Fly  2538 DEYAHREERVVRGNVAQRG 2556
            |...|..|.|...|..|.|
  Fly  1218 DHARHNLENVRIVNNLQDG 1236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teqNP_648288.2 CBM_14 65..115 CDD:279884
ChtBD2 136..184 CDD:214696
ChtBD2 215..261 CDD:214696
ChtBD2 284..327 CDD:214696
CBM_14 521..569 CDD:279884
ChtBD2 608..654 CDD:214696
ChtBD2 709..752 CDD:214696
CBM_14 782..830 CDD:279884
ChtBD2 864..909 CDD:214696
CBM_14 942..993 CDD:279884
RCR <1051..1126 CDD:304939
RCR <1116..1210 CDD:304939
ChtBD2 1324..1369 CDD:214696
ChtBD2 1474..1518 CDD:214696
LDLa 2193..2222 CDD:238060
SR 2229..2331 CDD:214555
SRCR 2234..2332 CDD:278931
LDLa 2337..2370 CDD:197566 2/10 (20%)
SR 2382..2480 CDD:214555 32/102 (31%)
SRCR 2386..2480 CDD:278931 29/98 (30%)
Tryp_SPc 2546..2781 CDD:214473 4/11 (36%)
Tryp_SPc 2547..2784 CDD:238113 4/10 (40%)
barkNP_001245864.1 SR 191..295 CDD:214555
SRCR 196..294 CDD:278931
CUB 459..552 CDD:238001
Beta_helix 579..752 CDD:289971
SR 1071..1175 CDD:214555 32/103 (31%)
SRCR 1076..1174 CDD:278931 29/97 (30%)
SR 1932..2037 CDD:214555
SRCR 1932..2037 CDD:278931
CLECT 2604..2699 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6743
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.