DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment teq and Olr292

DIOPT Version :9

Sequence 1:NP_648288.2 Gene:teq / 39048 FlyBaseID:FBgn0023479 Length:2792 Species:Drosophila melanogaster
Sequence 2:NP_001000232.1 Gene:Olr292 / 293594 RGDID:1333185 Length:305 Species:Rattus norvegicus


Alignment Length:113 Identity:20/113 - (17%)
Similarity:35/113 - (30%) Gaps:45/113 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly  1431 SISHGFCKPVDQVQREDRLYTINELHIIFEWT--QKMMIVGAVT-------ACP----------- 1475
            |||:|.|..        :|:       .|.|:  .::::..|:.       .||           
  Rat    88 SISYGGCMA--------QLF-------FFTWSLGAELLLFSAMAYDRFVAICCPLHYSAWMGPRV 137

  Fly  1476 ----------EGITGTLPHPRVPTKYLRCGPGQAEMYDCPSQQIFSVS 1513
                      ..||.|..|..:..:...||..:.|.:.|....:..:|
  Rat   138 CAFLAGLVWSISITNTSVHTGLMLRLPFCGSNEIEHFFCEIPPLLKLS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teqNP_648288.2 CBM_14 65..115 CDD:279884
ChtBD2 136..184 CDD:214696
ChtBD2 215..261 CDD:214696
ChtBD2 284..327 CDD:214696
CBM_14 521..569 CDD:279884
ChtBD2 608..654 CDD:214696
ChtBD2 709..752 CDD:214696
CBM_14 782..830 CDD:279884
ChtBD2 864..909 CDD:214696
CBM_14 942..993 CDD:279884
RCR <1051..1126 CDD:304939
RCR <1116..1210 CDD:304939
ChtBD2 1324..1369 CDD:214696
ChtBD2 1474..1518 CDD:214696 11/61 (18%)
LDLa 2193..2222 CDD:238060
SR 2229..2331 CDD:214555
SRCR 2234..2332 CDD:278931
LDLa 2337..2370 CDD:197566
SR 2382..2480 CDD:214555
SRCR 2386..2480 CDD:278931
Tryp_SPc 2546..2781 CDD:214473
Tryp_SPc 2547..2784 CDD:238113
Olr292NP_001000232.1 7tm_4 30..303 CDD:304433 20/113 (18%)
7tm_1 39..287 CDD:278431 20/113 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7126
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D90326at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.