DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment teq and SSC4D

DIOPT Version :9

Sequence 1:NP_648288.2 Gene:teq / 39048 FlyBaseID:FBgn0023479 Length:2792 Species:Drosophila melanogaster
Sequence 2:XP_024302432.1 Gene:SSC4D / 136853 HGNCID:14461 Length:604 Species:Homo sapiens


Alignment Length:467 Identity:146/467 - (31%)
Similarity:187/467 - (40%) Gaps:131/467 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  2163 NDDWDLLPNSNAEEVTPKLATRSSF------------------NTQCD------FDCGN-----G 2198
            :||||::   :|..|..:|....:.                  |.:|.      .:||:     .
Human   113 DDDWDVV---DANVVCRQLGCGLALPVPRPLAFGQGRGPILLDNVECRGQEAALSECGSRGWGVH 174

  Fly  2199 QCLKKEEI---CD-----------------GKKNCPNGKDEANCPPSDYEVRLSGGESPNMGRIE 2243
            .|...|::   ||                 .....||||.|.:       |||.||.:...||:|
Human   175 NCFHYEDVAVLCDEFLPTQPPTRKMLTSRAPPTTLPNGKSEGS-------VRLVGGANLCQGRVE 232

  Fly  2244 VKANGQWGYVCDDKFGLKDADVVCRELGFQMGAQEVRGSSFYAPPNQDFNY-----LMDEVECHG 2303
            :..:|.||.||||.:||.||.||||:||.        |::..|..|..|.|     |:|.|.|.|
Human   233 ILHSGLWGTVCDDDWGLPDAAVVCRQLGC--------GAAMAATTNAFFGYGTGHILLDNVHCEG 289

  Fly  2304 NETKLGQCAFKGWGVHNCGVDEVAGVTC---------KVPVMKCPNNY-WLCHTSKECIPPAFVC 2358
            .|.:|..|...||||||||..|.||..|         .:|......:: |....|...:.|    
Human   290 GEPRLAACQSLGWGVHNCGHHEDAGALCAGLGPPTLTALPSSATREDWAWQTDPSATGVGP---- 350

  Fly  2359 DNTPDCADKSDECAAVCQA-------PVQYRLEGGRNSNEGRLEVKHHGVWGSVCDDDFNLKSAQ 2416
                   ..|.|.|.:..|       ..:.||.||.....||:||.|.|.||:|||||::...|:
Human   351 -------QPSRETALLTTAAWAAGKKSGRLRLVGGPGPCRGRVEVLHAGGWGTVCDDDWDFADAR 408

  Fly  2417 VACNSMGFFGPAKIEKNI--FGNSNGPIWLDQVMCFGNETSIDQCNHWNWGEHNCNHTEDVALHC 2479
            |||...| .|||.....:  ||...||:.||.|.|.|.|..:..|.|..||:|||.|.||....|
Human   409 VACREAG-CGPALGATGLGHFGYGRGPVLLDNVGCAGTEARLSDCFHLGWGQHNCGHHEDAGALC 472

  Fly  2480 SAGPPPRSQRYSQTQIKGGRSLGRETTPKTYSQIGLWERSSKAVHTPR-RCGIFKDDLTDEYAHR 2543
             |||.....:..|.        |.|||               .|.||| |.|..:  |.:. |||
Human   473 -AGPEELGLQVQQD--------GSETT---------------RVPTPRPRDGHLR--LVNG-AHR 510

  Fly  2544 EERVVRGNVAQR 2555
            .|..|...:.||
Human   511 CEGRVELYLGQR 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teqNP_648288.2 CBM_14 65..115 CDD:279884
ChtBD2 136..184 CDD:214696
ChtBD2 215..261 CDD:214696
ChtBD2 284..327 CDD:214696
CBM_14 521..569 CDD:279884
ChtBD2 608..654 CDD:214696
ChtBD2 709..752 CDD:214696
CBM_14 782..830 CDD:279884
ChtBD2 864..909 CDD:214696
CBM_14 942..993 CDD:279884
RCR <1051..1126 CDD:304939
RCR <1116..1210 CDD:304939
ChtBD2 1324..1369 CDD:214696
ChtBD2 1474..1518 CDD:214696
LDLa 2193..2222 CDD:238060 11/53 (21%)
SR 2229..2331 CDD:214555 49/106 (46%)
SRCR 2234..2332 CDD:278931 46/111 (41%)
LDLa 2337..2370 CDD:197566 4/33 (12%)
SR 2382..2480 CDD:214555 45/99 (45%)
SRCR 2386..2480 CDD:278931 42/95 (44%)
Tryp_SPc 2546..2781 CDD:214473 3/10 (30%)
Tryp_SPc 2547..2784 CDD:238113 3/9 (33%)
SSC4DXP_024302432.1 SR 87..186 CDD:214555 13/75 (17%)
SR 218..317 CDD:214555 49/106 (46%)
SR 373..472 CDD:214555 45/99 (45%)
SR 502..602 CDD:214555 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D158600at2759
OrthoFinder 1 1.000 - - FOG0001772
OrthoInspector 1 1.000 - - otm41013
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.