DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment teq and Gasp

DIOPT Version :10

Sequence 1:NP_648288.2 Gene:teq / 39048 FlyBaseID:FBgn0023479 Length:2792 Species:Drosophila melanogaster
Sequence 2:XP_003436437.2 Gene:Gasp / 1279776 VectorBaseID:AGAMI1_010775 Length:265 Species:Anopheles gambiae


Alignment Length:216 Identity:60/216 - (27%)
Similarity:88/216 - (40%) Gaps:53/216 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CPPHFTGLVAYPH--DCHRYVNCFDGSPTIQTCSPGTLFNDR-----TQVCDHPSNVVCPSAESA 122
            ||..| |.  |||  .|.:|..|.:....::||..|..|:..     |:.||:..||.|      
Mosquito    23 CPDDF-GF--YPHHSSCDKYWKCDNNVAELKTCGNGLAFDATDSKYLTENCDYLHNVDC------ 78

  Fly   123 STRLGRLRQLD---SEPKCQPGVNGLQPHPSDCSKFLNCANGQAFIMDCAPGTAFSPASLVCVHK 184
                |...||:   |.|.|: .:.|:....:.|..|.||.||:|....|:||.|:...:.||:..
Mosquito    79 ----GDRTQLEPPISTPHCE-RLYGIFADAAKCDVFWNCWNGEASRYQCSPGLAYDREARVCMWA 138

  Fly   185 D-LAKCGSGTGAVRDDTSGTGYPALPFDDLGCP-------PGTRGLRPHPHDVHKYLRCGIGVKP 241
            | :.:|       :::....|:        .||       .|:.....||.|..||..|..||..
Mosquito   139 DQVPEC-------KNEEVANGF--------ACPAAGEISNAGSFSRHAHPEDCRKYYICLEGVAR 188

  Fly   242 QVEQCPRGHIF-----DGSSS 257
            :. .||.|.:|     ||:.:
Mosquito   189 EY-GCPIGTVFKIGDADGTGN 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teqNP_648288.2 CBM_14 65..115 CDD:426342 18/56 (32%)
ChtBD2 136..184 CDD:214696 16/47 (34%)
ChtBD2 215..261 CDD:214696 17/55 (31%)
ChtBD2 284..327 CDD:214696
ChtBD2 521..567 CDD:214696
ChtBD2 608..654 CDD:214696
ChtBD2 709..752 CDD:214696
CBM_14 782..829 CDD:426342
ChtBD2 864..909 CDD:214696
CBM_14 942..993 CDD:426342
Med15 1029..>1325 CDD:312941
ChtBD2 1324..1369 CDD:214696
ChtBD2 1474..1518 CDD:214696
PHA03247 <1587..1906 CDD:223021
LDLa 2193..2222 CDD:238060
SR 2229..2331 CDD:214555
LDLa 2337..2370 CDD:197566
SR 2382..2480 CDD:214555
Tryp_SPc 2547..2784 CDD:238113
GaspXP_003436437.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.