DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OR4Q2 and Octbeta1R

DIOPT Version :9

Sequence 1:NP_001335200.1 Gene:OR4Q2 / 390432 HGNCID:15359 Length:313 Species:Homo sapiens
Sequence 2:NP_001262843.1 Gene:Octbeta1R / 42652 FlyBaseID:FBgn0038980 Length:508 Species:Drosophila melanogaster


Alignment Length:331 Identity:70/331 - (21%)
Similarity:126/331 - (38%) Gaps:93/331 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    33 FFYMSIWVGNVLIMVTVASDKYLNSSPMYFLLGNLSFLDLCYSTVTTPKLLADFFNHEKLISYD- 96
            |..::..:||:|::|:|...:.|.....||:: :|:..|:..:      |.|..||...:||.. 
  Fly   116 FIILAAILGNMLVIVSVMRHRKLRIITNYFVV-SLAVADMLVA------LCAMTFNASVMISGKW 173

Human    97 -----QCIVQLFFLHFVGAAEMFLLTVMAYDRYVAICRPLHYTTVMSQGLCCVLVAASWMGGFVH 156
                 .|.:...|..:...|.:..|..::.|||.||.:||.|..:|:|....:::...|:     
  Fly   174 MFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWL----- 233

Human   157 STVQTILTVHLPFCGP--NQVENFFCDVPPVIKLACADTFVIELLMVSNSGLI-STISF----VV 214
               ...|...||.|..  ...||:        |...::..:.|..:.....:: |::||    :|
  Fly   234 ---SPALLSFLPICSGWYTTTENY--------KYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIV 287

Human   215 LISSYTTIL--------VKIRSK----------------------EGRRKALST------CASHL 243
            ::|.|..|.        :..|||                      :..:..:||      .|..|
  Fly   288 MLSMYYRIYQEADRQERLVYRSKVAALLLEKHLQISQIPKPRPSIQVEQSTISTMRRERKAARTL 352

Human   244 MVVTLFFGPCIFIYARPFSTFSVDKMVSVLYNVITP---------------MLNPLIYTLRNKEV 293
            .::...|..|..    ||..:.:  :.|:..:.|||               .|||:||...|::.
  Fly   353 GIIMSAFLICWL----PFFLWYI--VSSLCDSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDF 411

Human   294 KSAMQK 299
            ::|.:|
  Fly   412 RAAFKK 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OR4Q2NP_001335200.1 7tmA_OR4Q2-like 25..290 CDD:320604 67/320 (21%)
TM helix 1 26..52 CDD:320604 6/18 (33%)
TM helix 2 60..86 CDD:320604 6/25 (24%)
TM helix 3 98..128 CDD:320604 8/29 (28%)
TM helix 4 141..162 CDD:320604 1/20 (5%)
TM helix 5 196..226 CDD:320604 8/42 (19%)
TM helix 6 230..260 CDD:320604 6/35 (17%)
TM helix 7 265..290 CDD:320604 9/39 (23%)
Octbeta1RNP_001262843.1 7tm_4 112..>231 CDD:304433 31/121 (26%)
7tm_1 124..404 CDD:278431 64/308 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.