DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OR4Q2 and 5-HT2B

DIOPT Version :9

Sequence 1:NP_001335200.1 Gene:OR4Q2 / 390432 HGNCID:15359 Length:313 Species:Homo sapiens
Sequence 2:NP_001262373.1 Gene:5-HT2B / 41017 FlyBaseID:FBgn0261929 Length:947 Species:Drosophila melanogaster


Alignment Length:230 Identity:48/230 - (20%)
Similarity:95/230 - (41%) Gaps:51/230 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    29 VLFLFFYMSIWVGNVLIMVTVASDKYLNSSPMYFLLGNLSFLDLCYSTVTTP----KLLADFFNH 89
            :|.|...:....||:|:.:.:|.::.|.:...|||: :|:..||..:.:..|    .|:..:|. 
  Fly    78 LLALVLVLGTAAGNILVCLAIAWERRLQNVTNYFLM-SLAITDLMVAVLVMPLGILTLVKGYFP- 140

Human    90 EKLISYDQCIVQLFF-LHFVGAAEMFLLTVMAYDRYVAICRPLHYTTVMSQGLCCVLVAASWMGG 153
               :..:.|:..:.. :.|..|:.|.|.|: :.|||:::..|:.:....::....:.:...|:  
  Fly   141 ---LGSEHCLTWICLDVLFCTASIMHLCTI-SVDRYLSLRYPMRFGRNKTRRRVTLKIVFVWL-- 199

Human   154 FVHSTVQTILTVHLPFC---GPNQVE---NFFCDVP-PVIKL----ACADTFVIELLMVSNSGLI 207
                   ..:.:.||..   ..|...   |..|.:| ||.||    .|   |.|.|         
  Fly   200 -------LSIAMSLPLSLMYSKNHASVLVNGTCQIPDPVYKLVGSIVC---FYIPL--------- 245

Human   208 STISFVVLISSYTTILVKIRSKE----GRRKALST 238
                .|:|::...|:.:..|.::    |::.|.:|
  Fly   246 ----GVMLLTYCLTVRLLARQRQNLGGGQQTAAAT 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OR4Q2NP_001335200.1 7tmA_OR4Q2-like 25..290 CDD:320604 48/230 (21%)
TM helix 1 26..52 CDD:320604 6/22 (27%)
TM helix 2 60..86 CDD:320604 8/29 (28%)
TM helix 3 98..128 CDD:320604 9/30 (30%)
TM helix 4 141..162 CDD:320604 1/20 (5%)
TM helix 5 196..226 CDD:320604 5/29 (17%)
TM helix 6 230..260 CDD:320604 3/13 (23%)
TM helix 7 265..290 CDD:320604
5-HT2BNP_001262373.1 7tm_1 90..>262 CDD:278431 42/202 (21%)
7tm_4 90..>238 CDD:304433 35/162 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.