DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OR4Q2 and srx-66

DIOPT Version :9

Sequence 1:NP_001335200.1 Gene:OR4Q2 / 390432 HGNCID:15359 Length:313 Species:Homo sapiens
Sequence 2:NP_504085.2 Gene:srx-66 / 187097 WormBaseID:WBGene00005957 Length:298 Species:Caenorhabditis elegans


Alignment Length:300 Identity:60/300 - (20%)
Similarity:107/300 - (35%) Gaps:87/300 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    29 VLFLFFYMSIWVGNVLIMVTVASDKYLNSSPMY-------------FLLGNLSFLDLCYSTV--- 77
            |||....:|| :|:|           ||.|..|             :|..|.:..|..:|||   
 Worm     7 VLFALVPISI-LGSV-----------LNWSSFYTIRKLASFKHSFGYLSSNQALADALHSTVFLL 59

Human    78 -TTPKLLADFFNHEKLISYDQ-C-IVQLFFLHFVGAAEMFLLT--VMAYDRYVAICRPLHYTTVM 137
             ..|..|.|   :..:..|.. | .:.|||.      |:.:||  :::.:|..::..|:.|....
 Worm    60 YFCPMALLD---NSLMKQYSHICGFILLFFY------ELSVLTHLLISLNRLFSVWFPIAYDKAF 115

Human   138 SQGLCCVLVAASWM--------------GGFVHSTVQTILTVHLPFCGPNQVENFFCDVPPVIKL 188
            :......::...||              ..:....::.:...:.|.||   :..::.|.      
 Worm   116 NLSKTKYMIFILWMFELTFALCFYEYLCHFYFDEKIRFLTFTNSPVCG---IVGWYGDF------ 171

Human   189 ACADTFVIELLMVSNSGLISTISFVVLI-----SSYTTILVKIRSKEGRRKALSTCAS----HLM 244
             ..:.|::.::|..:   |.|:..|.|:     |..:...|:..|...||....|...    .|.
 Worm   172 -LKNVFIVAIIMTLD---ICTLIKVKLLSCKLGSGISPASVRKLSSRDRRFLRQTVIQGSVFMLE 232

Human   245 VVTLFFGPCIF------IYARPFSTFSV---DKMVSVLYN 275
            ::|.||.|..|      .:...|:..:|   |.::.:|.|
 Worm   233 LLTYFFIPQYFENRWIVFFGTSFAWVAVHVADGLIVILCN 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OR4Q2NP_001335200.1 7tmA_OR4Q2-like 25..290 CDD:320604 59/299 (20%)
TM helix 1 26..52 CDD:320604 7/22 (32%)
TM helix 2 60..86 CDD:320604 9/42 (21%)
TM helix 3 98..128 CDD:320604 8/32 (25%)
TM helix 4 141..162 CDD:320604 2/34 (6%)
TM helix 5 196..226 CDD:320604 7/34 (21%)
TM helix 6 230..260 CDD:320604 9/39 (23%)
TM helix 7 265..290 CDD:320604 3/13 (23%)
srx-66NP_504085.2 TM helix 1 8..32 CDD:341315 10/35 (29%)
7TM_GPCR_Srx 13..272 CDD:370981 56/292 (19%)
TM helix 2 39..65 CDD:341315 7/25 (28%)
TM helix 3 77..106 CDD:341315 8/34 (24%)
TM helix 4 119..138 CDD:341315 2/18 (11%)
TM helix 5 163..187 CDD:341315 4/36 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.