| Sequence 1: | NP_001335200.1 | Gene: | OR4Q2 / 390432 | HGNCID: | 15359 | Length: | 313 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_508147.2 | Gene: | npr-19 / 182130 | WormBaseID: | WBGene00015364 | Length: | 420 | Species: | Caenorhabditis elegans |
| Alignment Length: | 335 | Identity: | 69/335 - (20%) |
|---|---|---|---|
| Similarity: | 127/335 - (37%) | Gaps: | 87/335 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Human 33 FFYMSIW--------VGNVLIMVTVASDKYLNSSPMYFLLGNLSFLDLCYSTVTTPKLLADFFNH 89
Human 90 EKLISYDQC--IVQLFFLHFVGAAEMFLLTVMAYDRYVAICRPLHYTTVMSQGLCCVLVAASWMG 152
Human 153 GFVHSTVQTILTVHLP----FCGPNQVENFFCDV--PPVIKLACADTFVIELLMVSNSGLISTIS 211
Human 212 FVVLISSYTTILVKIRSKEGRRKA-----------------------LSTCASHLMV-------- 245
Human 246 -------VTLFFGPCIFIYA------RPF---STFSVDKMVSVLYNVITPMLNPLIYTLRNKEVK 294
Human 295 SAMQKLWVRN 304 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| OR4Q2 | NP_001335200.1 | 7tmA_OR4Q2-like | 25..290 | CDD:320604 | 66/319 (21%) |
| TM helix 1 | 26..52 | CDD:320604 | 8/26 (31%) | ||
| TM helix 2 | 60..86 | CDD:320604 | 3/25 (12%) | ||
| TM helix 3 | 98..128 | CDD:320604 | 9/31 (29%) | ||
| TM helix 4 | 141..162 | CDD:320604 | 3/20 (15%) | ||
| TM helix 5 | 196..226 | CDD:320604 | 9/29 (31%) | ||
| TM helix 6 | 230..260 | CDD:320604 | 8/73 (11%) | ||
| TM helix 7 | 265..290 | CDD:320604 | 6/24 (25%) | ||
| npr-19 | NP_508147.2 | 7tm_classA_rhodopsin-like | 32..325 | CDD:381740 | 65/316 (21%) |
| TM helix 1 | 32..55 | CDD:381740 | 6/22 (27%) | ||
| TM helix 2 | 64..89 | CDD:381740 | 3/24 (13%) | ||
| TM helix 3 | 105..127 | CDD:381740 | 6/21 (29%) | ||
| TM helix 4 | 150..166 | CDD:381740 | 5/24 (21%) | ||
| TM helix 5 | 192..211 | CDD:381740 | 7/23 (30%) | ||
| TM helix 6 | 270..291 | CDD:381740 | 2/20 (10%) | ||
| TM helix 7 | 300..325 | CDD:381740 | 6/26 (23%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||