DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OR4Q2 and or70a13

DIOPT Version :9

Sequence 1:NP_001335200.1 Gene:OR4Q2 / 390432 HGNCID:15359 Length:313 Species:Homo sapiens
Sequence 2:NP_001122057.1 Gene:or70a13 / 100151263 ZFINID:ZDB-GENE-070806-11 Length:314 Species:Danio rerio


Alignment Length:301 Identity:95/301 - (31%)
Similarity:166/301 - (55%) Gaps:9/301 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    14 LSGFSQTPSIEAGLFVLFLFFYMSIWVGNVLIMVTVASDKYLNSSPMYFLLGNLSFLDLCYSTVT 78
            :.|...|......:|::....|:...:.|:.::..::::|.|: .||:||..||...|:..:||.
Zfish    13 VEGLKVTHQSSQPVFIVLFLSYIFAMISNITLIFLISTEKNLH-DPMHFLFCNLPVNDIIGTTVI 76

Human    79 TPKLLADFFNH--EKLISYDQCIVQLFFLHFVGAAEMFLLTVMAYDRYVAICRPLHYTTVMSQGL 141
            .|:|:.|....  |:.|||.:|:||.:|:|...||..::|.:||:|||||||.||.||.:|:..:
Zfish    77 LPRLMQDVLKEASERYISYTECVVQAYFVHVFTAACHYVLMIMAFDRYVAICNPLRYTAIMTNKM 141

Human   142 CCVLVAASWMGGFVHSTVQTILTVHLPFCGPNQVENFFCDVPPVIKLACADTFVIELLMVSNSGL 206
            ...|.|::|....:..||...||:.|..| .:.:||.|||...:.||:|.:..:.....|..|.:
Zfish   142 VIKLSASAWGLAIIVVTVMIGLTLRLSHC-RSTIENPFCDNASLFKLSCENVSINNAFGVVYSVI 205

Human   207 ISTISFVVLISSY---TTILVKIRSKEGRRKALSTCASHLMV-VTLFFGPCIFIYARPFSTFSVD 267
            ::.:|.:.:..:|   .|:.:..::|....||:.||::||.| :.:|....|||:...|..::..
Zfish   206 VACLSAISIFITYVKIATVCLASKNKALNSKAMKTCSTHLAVYLIMFVSGAIFIFLHRFPEYAES 270

Human   268 -KMVSVLYNVITPMLNPLIYTLRNKEVKSAMQKLWVRNGLT 307
             |:.|::::::.|.||||:|.|:.||::....||..|...|
Zfish   271 RKLGSIMFHIVPPGLNPLVYGLQTKEIRQRFVKLCRRKTST 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OR4Q2NP_001335200.1 7tmA_OR4Q2-like 25..290 CDD:320604 87/271 (32%)
TM helix 1 26..52 CDD:320604 3/25 (12%)
TM helix 2 60..86 CDD:320604 10/25 (40%)
TM helix 3 98..128 CDD:320604 15/29 (52%)
TM helix 4 141..162 CDD:320604 5/20 (25%)
TM helix 5 196..226 CDD:320604 5/32 (16%)
TM helix 6 230..260 CDD:320604 11/30 (37%)
TM helix 7 265..290 CDD:320604 9/25 (36%)
or70a13NP_001122057.1 7tm_4 32..304 CDD:304433 88/273 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.