DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4911 and fbxl3b

DIOPT Version :9

Sequence 1:NP_001286990.1 Gene:CG4911 / 39043 FlyBaseID:FBgn0035959 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001006075.1 Gene:fbxl3b / 450055 ZFINID:ZDB-GENE-041010-178 Length:162 Species:Danio rerio


Alignment Length:111 Identity:26/111 - (23%)
Similarity:43/111 - (38%) Gaps:27/111 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EWHRIPSVALNHIFDYLNPQDRRSAAGVCFSWRHALFQKRYFRNFRFQLDVGCDDQLAFFHRSMA 73
            :|.::|...|..|..||...||..|:.||..|..|......:|.|.|:|:......|        
Zfish    38 DWGQLPQEILLQILQYLPLLDRAIASQVCHRWNQAFHMPELWRCFEFELNQPASSYL-------- 94

  Fly    74 NLAMELIVVFDFQNAVHIQKMRGLLYKVAHCDNIQ----KLRFQTH 115
                         .|.|.:.::.::.:  |.:::|    |:|..||
Zfish    95 -------------QATHPELIKQIIKR--HANHLQYVSFKVRTHTH 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4911NP_001286990.1 F-box 8..53 CDD:279040 14/43 (33%)
fbxl3bNP_001006075.1 F-box-like 39..80 CDD:289689 13/40 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.