DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4911 and tat

DIOPT Version :9

Sequence 1:NP_001286990.1 Gene:CG4911 / 39043 FlyBaseID:FBgn0035959 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001006790.1 Gene:tat / 448486 XenbaseID:XB-GENE-973688 Length:456 Species:Xenopus tropicalis


Alignment Length:136 Identity:30/136 - (22%)
Similarity:48/136 - (35%) Gaps:38/136 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 EPLILFLSRKRQPCQLLDLGAIEALSYYGHDFLKAMGK-PQELLQLTLASIKYDPSHYPILSLDS 202
            |.|:....|...||.::. ||:|.:          |.| |||....|::..|.:           
 Frog   308 EGLVRLSQRILGPCSIVQ-GALEHI----------MNKTPQEFYDNTISFTKSN----------- 350

  Fly   203 TLLQKCAALQVLSLDYDTLSDELLHTIQVLPLRKLLIAVHGLDSEEHPDVSETAWSNFSDHFSSI 267
                       ..|.|.||| .:.....|.|...:.:.| |::.|..|:.....  :|::...|.
 Frog   351 -----------ADLCYTTLS-SVPGLCPVRPAGAMYLMV-GIEMEHFPEFESDV--DFTERMISE 400

  Fly   268 ELVLTL 273
            :.|..|
 Frog   401 QSVFCL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4911NP_001286990.1 F-box 8..53 CDD:279040
tatNP_001006790.1 TAT_ubiq 3..41 CDD:369474
tyr_amTase_E 42..443 CDD:273529 30/136 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165167333
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.