DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4911 and Fbxl12

DIOPT Version :9

Sequence 1:NP_001286990.1 Gene:CG4911 / 39043 FlyBaseID:FBgn0035959 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001273458.1 Gene:Fbxl12 / 30843 MGIID:1354738 Length:349 Species:Mus musculus


Alignment Length:246 Identity:48/246 - (19%)
Similarity:98/246 - (39%) Gaps:54/246 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RRSAAGVCFSWRHALFQKRYFRNFRFQLDVGCDDQLAFFHRSMANLAMELIVVFD-----FQNAV 89
            |.....||..|:..:                 ||:..:.|..:....|...|::.     ..:.:
Mouse    47 RNPGCRVCHRWKRLV-----------------DDRWLWRHVDLTLYTMRPKVMWHLLRRYMASRL 94

  Fly    90 HIQKMRGLLYKVAH---------------CDNIQKLRFQTHNVGLVAIGNMHSE-HLLAIEQCFV 138
            :..:|.|.|:..:.               |.|:::|.....::.:|.|.::.|. ..|.:..|  
Mouse    95 YSLRMGGYLFSGSQAPQLSPALMRALGQKCPNLKRLCLHVADLSMVPITSLPSTLRTLELHSC-- 157

  Fly   139 EPLILFLSRKRQP--CQLLDLGAIEALSYYGHDFLKAMGKPQELLQLTLASIKYDPSHYPI--LS 199
            |..:::|.:::.|  ..||:...::.:..:..:.|:.:.:.:.|..|.|...      |.:  ..
Mouse   158 EISMIWLQKEQDPTVLPLLECIVLDRVPAFRDEHLQGLTRFRALRSLVLGGT------YRVTETG 216

  Fly   200 LDSTLLQKCAALQVLSLDYDTLS-DELLHTI--QVLPLRKLLIAVHGLDSE 247
            ||:: ||:.:.||.|.:...||| |..|..|  .:..:||:.:.|.||.::
Mouse   217 LDAS-LQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVGGLSAQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4911NP_001286990.1 F-box 8..53 CDD:279040 4/22 (18%)
Fbxl12NP_001273458.1 F-box-like <51..73 CDD:289689 6/38 (16%)
leucine-rich repeat 127..148 CDD:275381 3/20 (15%)
AMN1 144..>249 CDD:187754 26/113 (23%)
leucine-rich repeat 149..175 CDD:275381 5/27 (19%)
leucine-rich repeat 176..200 CDD:275381 2/23 (9%)
leucine-rich repeat 201..226 CDD:275381 8/31 (26%)
leucine-rich repeat 227..252 CDD:275381 9/24 (38%)
leucine-rich repeat 253..276 CDD:275381 5/14 (36%)
leucine-rich repeat 277..306 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.