DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4911 and FBXL13

DIOPT Version :9

Sequence 1:NP_001286990.1 Gene:CG4911 / 39043 FlyBaseID:FBgn0035959 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001381423.1 Gene:FBXL13 / 222235 HGNCID:21658 Length:825 Species:Homo sapiens


Alignment Length:455 Identity:86/455 - (18%)
Similarity:164/455 - (36%) Gaps:125/455 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IPSVALNHIFDYLNPQDRRSAAGVCFSWRHALFQKRYFRNFRFQLDVGCDDQLAFFHRSMANLAM 77
            :|..|:..||.||:.:|    ..:|....||........:....:|..          |:.|:..
Human   248 LPERAILQIFFYLSLKD----VIICGQVNHAWMLMTQLNSLWNAIDFS----------SVKNVIP 298

  Fly    78 ELIVVFDFQ----NAVHIQKMRGLLYK------VAHCDNIQKLR------FQTHNVGLVAIG--- 123
            :..:|...|    |.:.: ..||.|.:      |:||.|:|:|.      |...::..::.|   
Human   299 DKYIVSTLQRWRLNVLRL-NFRGCLLRPKTFRSVSHCRNLQELNVSDCPTFTDESMRHISEGCPG 362

  Fly   124 ---------------------NMHSEHLLAIEQC--FVEPLILFLSRKRQPCQL--LDLGAIEAL 163
                                 :.|:...|::..|  |.:..:.:|:......:|  |||.....:
Human   363 VLCLNLSNTTITNRTMRLLPRHFHNLQNLSLAYCRRFTDKGLQYLNLGNGCHKLIYLDLSGCTQI 427

  Fly   164 SYYGHDFL--KAMGKPQELLQLTLASIKYDPSHYPILSLD--STLLQKCAALQVLSLDY---DTL 221
            |..|..::  ...|    ::.||:       :..|.|:.:  ..|::||:  ::.||.:   ..:
Human   428 SVQGFRYIANSCTG----IMHLTI-------NDMPTLTDNCVKALVEKCS--RITSLVFTGAPHI 479

  Fly   222 SDELLHTIQVLPLRKLLIAVHGLDSEEHPDVSETAWSNFSDHFSSIELVLTLVYAYEAIALLQHR 286
            ||.....:....|||:..       |.:..|::.::.....::.:    |:.:|..:...:....
Human   480 SDCTFRALSACKLRKIRF-------EGNKRVTDASFKFIDKNYPN----LSHIYMADCKGITDSS 533

  Fly   287 VLRSNMPVTHVRLLFCEKMNAEALDWMSLHYRETLRSIHYVDAPYKYSNR-MNSSRRVSLLQDPF 350
             |||..|:..:.:|  ...|...:..|.|.        .::|.|.....| :|.|..|.|.....
Human   534 -LRSLSPLKQLTVL--NLANCVRIGDMGLK--------QFLDGPASMRIRELNLSNCVRLSDASV 587

  Fly   351 VMMAWRCKQLEEIVVH----------GYLMDPHNLVGI-------------ARLRGRQLKRLEVS 392
            :.::.||..|..:.:.          ||:::..:||.|             ...|.::||.|.||
Human   588 MKLSERCPNLNYLSLRNCEHLTAQGIGYIVNIFSLVSIDLSGTDISNEGLNVLSRHKKLKELSVS 652

  Fly   393  392
            Human   653  652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4911NP_001286990.1 F-box 8..53 CDD:279040 10/39 (26%)
FBXL13NP_001381423.1 Sfi1 <112..>224 CDD:400658
F-box-like 245..289 CDD:403981 10/44 (23%)
leucine-rich repeat 285..312 CDD:275381 5/36 (14%)
AMN1 312..497 CDD:187754 38/198 (19%)
leucine-rich repeat 313..336 CDD:275381 6/23 (26%)
leucine-rich repeat 337..362 CDD:275381 4/24 (17%)
leucine-rich repeat 363..387 CDD:275381 0/23 (0%)
leucine-rich repeat 388..406 CDD:275381 3/17 (18%)
leucine-rich repeat 416..441 CDD:275381 6/24 (25%)
leucine-rich repeat 442..491 CDD:275381 11/57 (19%)
leucine-rich repeat 468..490 CDD:275381 4/21 (19%)
leucine-rich repeat 492..515 CDD:275381 5/29 (17%)
leucine-rich repeat 518..542 CDD:275381 6/24 (25%)
AMN1 529..737 CDD:187754 29/135 (21%)
leucine-rich repeat 543..570 CDD:275381 6/36 (17%)
leucine-rich repeat 571..596 CDD:275381 7/24 (29%)
leucine-rich repeat 597..645 CDD:275381 7/47 (15%)
leucine-rich repeat 646..671 CDD:275381 5/7 (71%)
leucine-rich repeat 672..697 CDD:275381
leucine-rich repeat 698..723 CDD:275381
leucine-rich repeat 724..749 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.