DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4911 and fbxl8

DIOPT Version :9

Sequence 1:NP_001286990.1 Gene:CG4911 / 39043 FlyBaseID:FBgn0035959 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_012816105.1 Gene:fbxl8 / 100158652 XenbaseID:XB-GENE-1012778 Length:373 Species:Xenopus tropicalis


Alignment Length:398 Identity:86/398 - (21%)
Similarity:149/398 - (37%) Gaps:105/398 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 WHRIPSVALNHIFDYLNPQDRRSAAGVCFSWRHALFQKR--YFRNFRFQLD------------VG 60
            |..:|...|..||.:|:..||...:.||..|..|:....  ::...|...|            ||
 Frog     5 WKHMPQEILAIIFYHLSLNDRFVVSQVCQLWAIAMASSPVWHYTEIRLVSDKDLLLLEGLRQYVG 69

  Fly    61 CDDQLAF-FHRSMANLAMELIVVFDFQNAVHIQKMRGLLYKVAHCDNIQKLRFQTHNVGLVAIGN 124
            ....|.. |::|.....|::|.:||                 ..|....||    .::.:|..|.
 Frog    70 QIKHLKLVFNQSKETNRMKVIEIFD-----------------CLCKESCKL----ESLNIVCCGE 113

  Fly   125 ---MHS--EHLLAIEQ-CFVEPLIL-FLSRKRQPCQLLDLGAIEALSYYGHDFLKAMGKPQELL- 181
               .:|  |.|.:|.. |...|:.| .:..:..|..|.|            ||::.:......| 
 Frog   114 NPFFYSGPEILTSIANLCRDSPIDLHHVDFRNVPFTLTD------------DFVRCIATSSPNLR 166

  Fly   182 -----------QLTLASIKYDPSHYPILSLDSTLLQKCAALQVLSLDYDTLSDELLHTIQV---L 232
                       :::.::||             .:|:.|..|.||...|.:|::::...|..   .
 Frog   167 SLYINNGTLVCKISTSAIK-------------EVLEVCPKLCVLGAFYCSLNEDVFKDIMKPHRP 218

  Fly   233 PLRKLLIAVHGLDSEEH-PDVSETAWSNFSDHFSSIELVLTLVYAYEAIALLQHRVLRSNMPVTH 296
            |...|.:....:|  :| ..:|:..|.:......|:.:.:...:...| ..:.| :|:.::||..
 Frog   219 PFNCLDLFCERMD--KHILAISDEVWRDLRCRHPSLHVNMAFDHTIPA-RKIPH-ILKPSIPVDT 279

  Fly   297 VRL-LFCEKMNAEALDWMSLHYRETLRSIHYVDAPYKYSNRMNSSRRVSLLQDPFVMMAWRCKQL 360
            ::| .|.|.||  .:.::|.||.:||:         |:..:..||   |.|....:.:|.:|.:|
 Frog   280 LQLNTFNEMMN--EIRFVSSHYSQTLQ---------KFVIQTTSS---SELDSALIDLAGKCSRL 330

  Fly   361 EEIVVHGY 368
            ||  ||.|
 Frog   331 EE--VHCY 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4911NP_001286990.1 F-box 8..53 CDD:279040 12/44 (27%)
fbxl8XP_012816105.1 F-box 5..47 CDD:395521 12/41 (29%)
leucine-rich repeat 103..133 CDD:275381 8/33 (24%)
leucine-rich repeat 138..164 CDD:275381 6/37 (16%)
leucine-rich repeat 165..193 CDD:275381 5/40 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.