DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Argk and ckmt2b

DIOPT Version :9

Sequence 1:NP_729446.1 Gene:Argk / 39041 FlyBaseID:FBgn0000116 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_956991.1 Gene:ckmt2b / 799492 ZFINID:ZDB-GENE-040426-1654 Length:413 Species:Danio rerio


Alignment Length:338 Identity:144/338 - (42%)
Similarity:210/338 - (62%) Gaps:15/338 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 LTKEVFDNLKNKVTPTFKSTLLDVIQSGLEN--HD--SGVGIYAPDAEAYTVFADLFDPIIEDYH 296
            ||..::..|::|:||. ..::...||:|::|  |.  ..||:.|.|.|:|.||||||||:|:|.|
Zfish    63 LTPAIYGRLRDKLTPN-NWSVDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKDRH 126

  Fly   297 GGF-KKTDKHPASNFGDVSTFGNVDPTNEYVISTRVRCGRSMQGYPFNPCLTEAQYKEMESKVSS 360
            .|: .||.|||........|.|..|  .:||:|:|||.|||::|....|..:.|:.:|:|.....
Zfish   127 NGYDPKTMKHPTDLDSSKITNGMFD--EKYVLSSRVRTGRSIRGLSLPPACSRAERREVERVTVQ 189

  Fly   361 TLSGLEGELKGKFYPLTGMEKAVQQQLIDDHFLF-KEGDRFLQAANACRFWPSGRGIYHNDAKTF 424
            .||||:.:|.||:|.||.|.:..||||||:|||| |.....|.|:...|.||..|||:||:.|||
Zfish   190 ALSGLKDDLAGKYYSLTEMTEQEQQQLIDEHFLFDKPVSPLLTASGMARDWPDARGIWHNNEKTF 254

  Fly   425 LVWCNEEDHLRIISMQQGGDLGQIYKRLVTAVNEIEKRV-----PFSHDDRLGFLTFCPTNLGTT 484
            |:|.|||||.|:|||::||::.::::|....:.|:|:.:     .|..::|||::..||:||||.
Zfish   255 LIWINEEDHTRVISMEKGGNMQRVFERFCRGLKEVERLIEERGWEFMWNERLGYILTCPSNLGTG 319

  Fly   485 IRASVHIKVPKLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMY 549
            :||.||:::|.|:.:| :..::.....||.|||.|..|.|.|..:||||..|:|.:|.|.|:.:.
Zfish   320 LRAGVHVRLPILSKDK-RFNKILDNLRLQKRGTGGVDTAAVGDTFDISNLDRLGKSEVELVQCVV 383

  Fly   550 DGITELIKLEKSL 562
            ||:..||..||.|
Zfish   384 DGVNYLIDCEKKL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArgkNP_729446.1 arginine_kinase_like 215..562 CDD:153079 143/336 (43%)
ckmt2bNP_956991.1 creatine_kinase_like 45..402 CDD:153076 144/338 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 198 1.000 Domainoid score I3023
eggNOG 1 0.900 - - E1_COG3869
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 288 1.000 Inparanoid score I2808
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D287050at33208
OrthoFinder 1 1.000 - - FOG0000437
OrthoInspector 1 1.000 - - mtm6403
orthoMCL 1 0.900 - - OOG6_100675
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X315
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.730

Return to query results.
Submit another query.