DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Argk and zgc:172076

DIOPT Version :9

Sequence 1:NP_729446.1 Gene:Argk / 39041 FlyBaseID:FBgn0000116 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001107070.1 Gene:zgc:172076 / 563955 ZFINID:ZDB-GENE-080204-38 Length:317 Species:Danio rerio


Alignment Length:316 Identity:92/316 - (29%)
Similarity:150/316 - (47%) Gaps:33/316 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 GLENHDSG-------VGIYAPDAEAYTVFADLFDPIIEDYHGGFKKTDKHPASNFGDVSTFGNVD 320
            |||  |.|       ||..|.||::|.:|.|.||.|||.|||....:|....|:|...:..|..|
Zfish     5 GLE--DPGQSTGTKSVGCLAGDAQSYILFCDFFDRIIESYHGYKVTSDAVHESDFNYDNLKGGDD 67

  Fly   321 PTNEYVISTRVRCGRSMQGYPFNPCLTEAQYKEMESKVSSTLSGLEGELKGKFYPLTGMEKAVQQ 385
            ....||....|...||::.:.|....:..:.:.:.:..::.|..|..:|.||.|.:..:....:.
Zfish    68 FDPAYVSGCEVTVSRSVEDFSFPTHCSRGERRRLLTLANTALEQLGEDLPGKLYSIDELSHESED 132

  Fly   386 QLIDDHF----LFKEGDRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHLRIISMQQGGDLG 446
            :.:...|    |.|.|        ..|.||..|.::.:...:..||.|.||||:::|.:....|.
Zfish   133 RKVVMEFPPASLIKIG--------VARDWPDARALWLSKDGSLAVWVNMEDHLKLVSYRSDASLQ 189

  Fly   447 QIYKRLVTAVNEIEK-----RVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEV 506
            :.:|.:...|.::|.     |..|.....||::...|..:||.::|||.:.:..||.|| :|:::
Zfish   190 EAFKTICINVQKLETLYKKLRHTFIWKTHLGWVVSSPAEVGTGLKASVSVNLLNLAKNK-RLDDI 253

  Fly   507 AAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELIKLEKSL 562
            ..:..||:      .|.::.|||.|||.:.:|:||....:.:.||:..||::||.|
Zfish   254 LDRLRLQM------ETTSDPGVYKISNLQTIGVTEVGLTQLVVDGVKLLIRMEKRL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArgkNP_729446.1 arginine_kinase_like 215..562 CDD:153079 91/314 (29%)
zgc:172076NP_001107070.1 phosphagen_kinases 3..309 CDD:295496 92/316 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D287050at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.