DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Argk and Ckmt1

DIOPT Version :9

Sequence 1:NP_729446.1 Gene:Argk / 39041 FlyBaseID:FBgn0000116 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001012756.1 Gene:Ckmt1 / 29593 RGDID:61976 Length:418 Species:Rattus norvegicus


Alignment Length:342 Identity:148/342 - (43%)
Similarity:210/342 - (61%) Gaps:15/342 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 LKKYLTKEVFDNLKNKVTPTFKSTLLDVIQSGLEN--HD--SGVGIYAPDAEAYTVFADLFDPII 292
            :..:||..|:..|.:|.||| ..||...||:|::|  |.  ..||:.|.|.|.|.|||:||||:|
  Rat    64 MASHLTPAVYARLCDKTTPT-GWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFAELFDPVI 127

  Fly   293 EDYHGGF-KKTDKHPASNFGDVSTFGNVDPTNEYVISTRVRCGRSMQGYPFNPCLTEAQYKEMES 356
            ::.|.|: .:|.||...........|..|  ..||:|:|||.|||::|....|..|.|:.:|:|.
  Rat   128 QERHNGYDPRTMKHTTDLDASKIRSGYFD--ERYVLSSRVRTGRSIRGLSLPPACTRAERREVER 190

  Fly   357 KVSSTLSGLEGELKGKFYPLTGMEKAVQQQLIDDHFLF-KEGDRFLQAANACRFWPSGRGIYHND 420
            .|...||||:|:|.|::|.|:.|.:|.||||||||||| |.....|.||...|.||..|||:||:
  Rat   191 VVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNN 255

  Fly   421 AKTFLVWCNEEDHLRIISMQQGGDLGQIYKRLVTAVNEIEKRV-----PFSHDDRLGFLTFCPTN 480
            .|:||:|.|||||.|:|||::||::.::::|....:.|:||.:     .|..::|||::..||:|
  Rat   256 EKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVEKLIQERGWEFMWNERLGYILTCPSN 320

  Fly   481 LGTTIRASVHIKVPKLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAV 545
            |||.:||.||:|:| |.|..::..::.....||.|||.|..|.|.|.|:||||..|:|.:|.|.|
  Rat   321 LGTGLRAGVHVKLP-LLSKDSRFPKILENLRLQKRGTGGVDTAATGSVFDISNLDRLGKSEVELV 384

  Fly   546 KEMYDGITELIKLEKSL 562
            :.:.||:..||..|:.|
  Rat   385 QLVIDGVNYLIDCERRL 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArgkNP_729446.1 arginine_kinase_like 215..562 CDD:153079 147/340 (43%)
Ckmt1NP_001012756.1 Cardiolipin-binding. /evidence=ECO:0000250 40..64 148/342 (43%)
creatine_kinase_like 50..407 CDD:153076 148/342 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 197 1.000 Domainoid score I3004
eggNOG 1 0.900 - - E1_COG3869
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 282 1.000 Inparanoid score I2802
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D287050at33208
OrthoFinder 1 1.000 - - FOG0000437
OrthoInspector 1 1.000 - - mtm9032
orthoMCL 1 0.900 - - OOG6_100675
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X315
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.