powered by:
Protein Alignment Argk and F11G11.13
DIOPT Version :9
Sequence 1: | NP_729446.1 |
Gene: | Argk / 39041 |
FlyBaseID: | FBgn0000116 |
Length: | 562 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_494881.2 |
Gene: | F11G11.13 / 184367 |
WormBaseID: | WBGene00017388 |
Length: | 57 |
Species: | Caenorhabditis elegans |
Alignment Length: | 47 |
Identity: | 27/47 - (57%) |
Similarity: | 42/47 - (89%) |
Gaps: | 0/47 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 512 LQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELIKL 558
||:||..||:::.:.|:||||||:|:||||::||::||||:.:||:|
Worm 3 LQIRGIHGEYSDLKEGIYDISNKQRLGLTEYQAVRQMYDGLKKLIEL 49
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG3869 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S3995 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D825025at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000437 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.770 |
|
Return to query results.
Submit another query.