DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Argk and F11G11.13

DIOPT Version :9

Sequence 1:NP_729446.1 Gene:Argk / 39041 FlyBaseID:FBgn0000116 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_494881.2 Gene:F11G11.13 / 184367 WormBaseID:WBGene00017388 Length:57 Species:Caenorhabditis elegans


Alignment Length:47 Identity:27/47 - (57%)
Similarity:42/47 - (89%) Gaps:0/47 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   512 LQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELIKL 558
            ||:||..||:::.:.|:||||||:|:||||::||::||||:.:||:|
 Worm     3 LQIRGIHGEYSDLKEGIYDISNKQRLGLTEYQAVRQMYDGLKKLIEL 49

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArgkNP_729446.1 arginine_kinase_like 215..562 CDD:153079 27/47 (57%)
F11G11.13NP_494881.2 phosphagen_kinases <2..49 CDD:383141 26/45 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3869
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3995
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825025at2759
OrthoFinder 1 1.000 - - FOG0000437
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.