DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Argk and CKMT2

DIOPT Version :9

Sequence 1:NP_729446.1 Gene:Argk / 39041 FlyBaseID:FBgn0000116 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001093205.1 Gene:CKMT2 / 1160 HGNCID:1996 Length:419 Species:Homo sapiens


Alignment Length:338 Identity:144/338 - (42%)
Similarity:205/338 - (60%) Gaps:15/338 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 LTKEVFDNLKNKVTPTFKSTLLDVIQSGLEN--HD--SGVGIYAPDAEAYTVFADLFDPIIEDYH 296
            ||..::..|:|||||. ..||...||:|::|  |.  ..||:.|.|.|:|.||||||||:|:..|
Human    68 LTPAIYAKLRNKVTPN-GYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRH 131

  Fly   297 GGF-KKTDKHPASNFGDVSTFGNVDPTNEYVISTRVRCGRSMQGYPFNPCLTEAQYKEMESKVSS 360
            .|: .:..||.........|.|..|  ..||:|:|||.|||::|....|..|.|:.:|:|:...:
Human   132 NGYDPRVMKHTTDLDASKITQGQFD--EHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAIT 194

  Fly   361 TLSGLEGELKGKFYPLTGMEKAVQQQLIDDHFLF-KEGDRFLQAANACRFWPSGRGIYHNDAKTF 424
            .|.||:|:|.|::|.|:.|.:..||:|||||||| |.....|..|...|.||..|||:||..|||
Human   195 ALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTF 259

  Fly   425 LVWCNEEDHLRIISMQQGGDLGQIYKRLVTAVNEIEKRV-----PFSHDDRLGFLTFCPTNLGTT 484
            |:|.|||||.|:|||::||::.::::|....:.|:|:.:     .|..::|||::..||:||||.
Human   260 LIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTG 324

  Fly   485 IRASVHIKVPKLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMY 549
            :||.||:::||| |...:..::.....||.|||.|..|.|...||||||..|:|.:|.|.|:.:.
Human   325 LRAGVHVRIPKL-SKDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVI 388

  Fly   550 DGITELIKLEKSL 562
            ||:..|:..||.|
Human   389 DGVNYLVDCEKKL 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ArgkNP_729446.1 arginine_kinase_like 215..562 CDD:153079 143/336 (43%)
CKMT2NP_001093205.1 Cardiolipin-binding. /evidence=ECO:0000250 40..64
creatine_kinase_like 50..407 CDD:153076 144/338 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 196 1.000 Domainoid score I3115
eggNOG 1 0.900 - - E1_COG3869
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 280 1.000 Inparanoid score I2904
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D287050at33208
OrthoFinder 1 1.000 - - FOG0000437
OrthoInspector 1 1.000 - - mtm8556
orthoMCL 1 0.900 - - OOG6_100675
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2592
SonicParanoid 1 1.000 - - X315
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.760

Return to query results.
Submit another query.