DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5144 and ckmt2b

DIOPT Version :9

Sequence 1:NP_648284.1 Gene:CG5144 / 39040 FlyBaseID:FBgn0035957 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_956991.1 Gene:ckmt2b / 799492 ZFINID:ZDB-GENE-040426-1654 Length:413 Species:Danio rerio


Alignment Length:356 Identity:140/356 - (39%)
Similarity:209/356 - (58%) Gaps:38/356 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LKKH-------LTKEIFEKLKTKTTPSFNSTLLHCISSGMCN--HD--SGVGLYAPDPEAYKVFA 108
            |:||       ||..|:.:|:.|.||: |.::..||.:|:.|  |.  ..||:.|.|.|:|:|||
Zfish    52 LRKHNNCMASALTPAIYGRLRDKLTPN-NWSVDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFA 115

  Fly   109 DLFDPVIEEYHKCF-KKTDKQPATAFGKGADFENLDP--------DGHFIVSTRVRCGRAVKGYP 164
            |||||||::.|..: .||.|.|.          :||.        |..:::|:|||.||:::|..
Zfish   116 DLFDPVIKDRHNGYDPKTMKHPT----------DLDSSKITNGMFDEKYVLSSRVRTGRSIRGLS 170

  Fly   165 FNPCLTEADYMELESKICGAVTSLTGEYKGKYMPLTGMDKCIQEQLIEDHYLF-KEGDRFLASAG 228
            ..|..:.|:..|:|.....|::.|..:..|||..||.|.:..|:|||::|:|| |.....|.::|
Zfish   171 LPPACSRAERREVERVTVQALSGLKDDLAGKYYSLTEMTEQEQQQLIDEHFLFDKPVSPLLTASG 235

  Fly   229 ASRYWPTGRGIFLNSAKNFLVWCNEEDHIRIISMEKGGDLGKVYDRMVGGVEALGKQL-----QF 288
            .:|.||..|||:.|:.|.||:|.|||||.|:|||||||::.:|::|...|::.:.:.:     :|
Zfish   236 MARDWPDARGIWHNNEKTFLIWINEEDHTRVISMEKGGNMQRVFERFCRGLKEVERLIEERGWEF 300

  Fly   289 NRDERLGFLTFCPTNLGTSIRASVHIKLPNLMCDPDEMKKLADKYRLQIRGTSGEHSEAKGGVHD 353
            ..:||||::..||:||||.:||.||::||.|..| ....|:.|..|||.|||.|..:.|.|...|
Zfish   301 MWNERLGYILTCPSNLGTGLRAGVHVRLPILSKD-KRFNKILDNLRLQKRGTGGVDTAAVGDTFD 364

  Fly   354 ISNQRRMGLTEYEIIKEMHDGIKGLIEAECK 384
            |||..|:|.:|.|:::.:.||:..||:.|.|
Zfish   365 ISNLDRLGKSEVELVQCVVDGVNYLIDCEKK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5144NP_648284.1 arginine_kinase_like 40..382 CDD:153079 138/352 (39%)
ckmt2bNP_956991.1 creatine_kinase_like 45..402 CDD:153076 140/356 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 198 1.000 Domainoid score I3023
eggNOG 1 0.900 - - E1_COG3869
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 288 1.000 Inparanoid score I2808
OMA 1 1.010 - - QHG58958
OrthoDB 1 1.010 - - D287050at33208
OrthoFinder 1 1.000 - - FOG0000437
OrthoInspector 1 1.000 - - mtm6403
orthoMCL 1 0.900 - - OOG6_100675
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X315
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.740

Return to query results.
Submit another query.