DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5144 and ckmt1b

DIOPT Version :9

Sequence 1:NP_648284.1 Gene:CG5144 / 39040 FlyBaseID:FBgn0035957 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_989369.1 Gene:ckmt1b / 395000 XenbaseID:XB-GENE-478738 Length:417 Species:Xenopus tropicalis


Alignment Length:379 Identity:149/379 - (39%)
Similarity:212/379 - (55%) Gaps:23/379 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AQLVINRHASKGNVDKEVMEQMEKGYKKLAESKSKSLLKKHLTKEIFEKLKTKTTPSFNSTLLHC 82
            |..::.|.|...:.....:......|..|  .|..:.:..:||..|:.||..|.||: ..|:..|
 Frog    28 AGYLMTREAISADTSNRRLYPASAEYPDL--RKHNNCMASNLTPAIYTKLCDKKTPA-GFTVDQC 89

  Fly    83 ISSGMCN--HD--SGVGLYAPDPEAYKVFADLFDPVIEEYHKCF-KKTDKQPATAFG---KGADF 139
            |.:|:.|  |.  ..||:.|.|.|.|:||||||||||:|.|..: .:|.|.|.....   ||..|
 Frog    90 IQTGVDNPGHPFIKTVGMVAGDEECYEVFADLFDPVIKERHNGYDPRTMKHPTDLDASKIKGGFF 154

  Fly   140 ENLDPDGHFIVSTRVRCGRAVKGYPFNPCLTEADYMELESKICGAVTSLTGEYKGKYMPLTGMDK 204
                 |..:::|:|||.||:::|....|..|.|:..|:|.....|:..|.|:..|.|..||.|.:
 Frog   155 -----DERYVLSSRVRTGRSIRGLSLPPACTRAERREVEKVTADALNGLQGDLSGHYYSLTQMTE 214

  Fly   205 CIQEQLIEDHYLF-KEGDRFLASAGASRYWPTGRGIFLNSAKNFLVWCNEEDHIRIISMEKGGDL 268
            ..|:|||:||:|| |.....|.:||.:|.||..|||:.|:.|.||:|.|||||.|:|||||||::
 Frog   215 KQQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKTFLIWINEEDHTRVISMEKGGNM 279

  Fly   269 GKVYDRMVGGVEALGKQLQ-----FNRDERLGFLTFCPTNLGTSIRASVHIKLPNLMCDPDEMKK 328
            .:|::|...|::.:.:.:|     |..:||||::..||:||||.:||.||||||.|..|. ...|
 Frog   280 KRVFERFCRGLKEVERLIQEKGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDA-RFAK 343

  Fly   329 LADKYRLQIRGTSGEHSEAKGGVHDISNQRRMGLTEYEIIKEMHDGIKGLIEAE 382
            :.:..|||.|||.|..:.|.|...||||..|:|.:|.|:.:.:.||:..||:.|
 Frog   344 ILENLRLQKRGTGGVDTAAVGSTFDISNLDRLGKSEVELTQMVIDGVNYLIDCE 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5144NP_648284.1 arginine_kinase_like 40..382 CDD:153079 145/355 (41%)
ckmt1bNP_989369.1 creatine_kinase_like 49..406 CDD:153076 146/358 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 197 1.000 Domainoid score I3041
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 289 1.000 Inparanoid score I2750
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D287050at33208
OrthoFinder 1 1.000 - - FOG0000437
OrthoInspector 1 1.000 - - mtm9449
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X315
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.