DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5144 and CKM

DIOPT Version :9

Sequence 1:NP_648284.1 Gene:CG5144 / 39040 FlyBaseID:FBgn0035957 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001815.2 Gene:CKM / 1158 HGNCID:1994 Length:381 Species:Homo sapiens


Alignment Length:361 Identity:146/361 - (40%)
Similarity:216/361 - (59%) Gaps:27/361 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EKGYKKLAESKSKSLLKKHLTKEIFEKLKTKTTPSFNSTLLHCISSGMCN--HD--SGVGLYAPD 100
            |:.|..|  ||..:.:.|.||.|:::||:.|.||| ..|:...|.:|:.|  |.  ..||..|.|
Human    17 EEEYPDL--SKHNNHMAKVLTLELYKKLRDKETPS-GFTVDDVIQTGVDNPGHPFIMTVGCVAGD 78

  Fly   101 PEAYKVFADLFDPVIEEYHKCFKKTDKQPATAFGKGADFENL----DPDGHFIVSTRVRCGRAVK 161
            .|:|:||.:||||:|.:.|..:|.|||...     ..:.|||    |.|.::::|:|||.||::|
Human    79 EESYEVFKELFDPIISDRHGGYKPTDKHKT-----DLNHENLKGGDDLDPNYVLSSRVRTGRSIK 138

  Fly   162 GYPFNPCLTEADYMELESKICGAVTSLTGEYKGKYMPLTGMDKCIQEQLIEDHYLF-KEGDRFLA 225
            ||...|..:..:...:|.....|:.|||||:||||.||..|.:..|:|||:||:|| |.....|.
Human   139 GYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLL 203

  Fly   226 SAGASRYWPTGRGIFLNSAKNFLVWCNEEDHIRIISMEKGGDLGKVYDRMVGGVEAL-------G 283
            ::|.:|.||..|||:.|..|:||||.|||||:|:|||||||::.:|:.|...|::.:       |
Human   204 ASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAG 268

  Fly   284 KQLQFNRDERLGFLTFCPTNLGTSIRASVHIKLPNLMCDPDEMKKLADKYRLQIRGTSGEHSEAK 348
            ....:|  :.||::..||:||||.:|..||:||.:|...| :.:::..:.|||.|||.|..:.|.
Human   269 HPFMWN--QHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHP-KFEEILTRLRLQKRGTGGVDTAAV 330

  Fly   349 GGVHDISNQRRMGLTEYEIIKEMHDGIKGLIEAECK 384
            |.|.|:||..|:|.:|.|.::.:.||:|.::|.|.|
Human   331 GSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKK 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5144NP_648284.1 arginine_kinase_like 40..382 CDD:153079 144/357 (40%)
CKMNP_001815.2 creatine_kinase_like 16..373 CDD:153076 146/361 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147543
Domainoid 1 1.000 196 1.000 Domainoid score I3115
eggNOG 1 0.900 - - E1_COG3869
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 280 1.000 Inparanoid score I2904
Isobase 1 0.950 - 0 Normalized mean entropy S3995
OMA 1 1.010 - - QHG58958
OrthoDB 1 1.010 - - D287050at33208
OrthoFinder 1 1.000 - - FOG0000437
OrthoInspector 1 1.000 - - mtm8556
orthoMCL 1 0.900 - - OOG6_100675
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X315
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.620

Return to query results.
Submit another query.