DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doc1 and TBX19

DIOPT Version :9

Sequence 1:NP_648283.1 Gene:Doc1 / 39039 FlyBaseID:FBgn0028789 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_005140.1 Gene:TBX19 / 9095 HGNCID:11596 Length:448 Species:Homo sapiens


Alignment Length:388 Identity:126/388 - (32%)
Similarity:183/388 - (47%) Gaps:91/388 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PTLPGVEAKLENNDLWQQFHKIGTEMIITKSGRRMFPSMRVSLSGLEEEASYCVLLEMVPIGDCR 118
            ||...::..||:..|||:|.::..|||:||:||||||.:::|::||:..|.|.:||:.||....|
Human    36 PTEKQLQIILEDAPLWQRFKEVTNEMIVTKNGRRMFPVLKISVTGLDPNAMYSLLLDFVPTDSHR 100

  Fly   119 YKFSGSQWVPAGGAEPQSPQRMYLHPDSPATGAHWQSQALLFNKVKLTNNTLDSSGHIVLASMHK 183
            :|:...:|||||..|..|...:|:|||||..||||....:.|:||||||. |:..|.|:|.|:||
Human   101 WKYVNGEWVPAGKPEVSSHSCVYIHPDSPNFGAHWMKAPISFSKVKLTNK-LNGGGQIMLNSLHK 164

  Fly   184 YQPRLHIIRSSELTQLPWAPQQAFVFPETEFVAVTAYQNDRITKLKIDNNPFAKGFRESGQSRCK 248
            |:|::||:|.....::    .....||||:|:|||||||:.||.|||..|||||.|.::.:....
Human   165 YEPQVHIVRVGSAHRM----VTNCSFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERNHL 225

  Fly   249 RKLN--------------------------SSGNSTLE--------------------------- 260
            |.:.                          ::|||..:                           
Human   226 RDVPEAISESQHVTYSHLGGWIFSNPDGVCTAGNSNYQYAAPLPLPAPHTHHGCEHYSGLRGHRQ 290

  Fly   261 --------SEDDGSSVSSCDSPQAKRQRQDFE-QDSTGSVSPAYYGA------THPVANP-MSPY 309
                    ..:...||:..:|  :....|.|. .||..|:|...:.:      |:...|| .|||
Human   291 APYPSAYMHRNHSPSVNLIES--SSNNLQVFSGPDSWTSLSSTPHASILSVPHTNGPINPGPSPY 353

  Fly   310 -LRHHLSYGPSGAAGLPPSIAAAYFGGV---------PPQILPMPPATYAPTVAPVSPVASQP 362
             ....:|.|..|.:|..|.:.|:..|..         ||.:|    :|.|||.|.|. |..:|
Human   354 PCLWTISNGAGGPSGPGPEVHASTPGAFLLGNPAVTSPPSVL----STQAPTSAGVE-VLGEP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Doc1NP_648283.1 TBOX 58..245 CDD:238106 87/186 (47%)
TBX19NP_005140.1 T-box 43..218 CDD:307177 87/179 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.