DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doc1 and EOMES

DIOPT Version :9

Sequence 1:NP_648283.1 Gene:Doc1 / 39039 FlyBaseID:FBgn0028789 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001265111.1 Gene:EOMES / 8320 HGNCID:3372 Length:705 Species:Homo sapiens


Alignment Length:445 Identity:142/445 - (31%)
Similarity:193/445 - (43%) Gaps:141/445 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 HMMLPSRPTLPGVEAKLENNDLWQQFHKIGTEMIITKSGRRMFPSMRVSLSGLEEEASYCVLLEM 111
            |:.|.:||             ||.:||:..|||||||.||||||.:..:::||...|.|.|.:|:
Human   268 HVYLCNRP-------------LWLKFHRHQTEMIITKQGRRMFPFLSFNINGLNPTAHYNVFVEV 319

  Fly   112 VPIGDCRYKFSGSQWVPAGGAE-PQSPQRMYLHPDSPATGAHWQSQALLFNKVKLTNN---TLDS 172
            |......::|.|.:||..|.|: .....:||:||:||.||:||..|.:.|.|:|||||   ..::
Human   320 VLADPNHWRFQGGKWVTCGKADNNMQGNKMYVHPESPNTGSHWMRQEISFGKLKLTNNKGANNNN 384

  Fly   173 SGHIVLASMHKYQPRLHIIRSSE-----LTQLPWAPQQAFVFPETEFVAVTAYQNDRITKLKIDN 232
            :..|||.|:|||||||||:..:|     |.: | :..|.|.|.||:|:|||||||..||:||||:
Human   385 TQMIVLQSLHKYQPRLHIVEVTEDGVEDLNE-P-SKTQTFTFSETQFIAVTAYQNTDITQLKIDH 447

  Fly   233 NPFAKGFRESGQSRCKRKLNSSGNSTLESEDDGSSVSSCDSPQAKR------------------- 278
            ||||||||::..|           ....||:|..:.|..|||::.:                   
Human   448 NPFAKGFRDNYDS-----------MYTASENDRLTPSPTDSPRSHQIVPGGRYGVQSFFPEPFVN 501

  Fly   279 ---QRQDFEQDST-----GSVSPAYYGATHPVANP------------------------------ 305
               |.:.:..:.|     |.:||.   .:..||||                              
Human   502 TLPQARYYNGERTVPQTNGLLSPQ---QSEEVANPPQRWLVTPVQQPGTNKLDISSYESEYTSST 563

  Fly   306 MSPY--------LRHHLSYGPSGAAGLPPSIAAAYFGG------VPPQILPMPPATYAPTVAPVS 356
            :.||        ..|.|.|.|.     |...|.|.:||      .....||....| :|||....
Human   564 LLPYGIKSLPLQTSHALGYYPD-----PTFPAMAGWGGRGSYQRKMAAGLPWTSRT-SPTVFSED 622

  Fly   357 PVASQPV----GSSTPTTSP----------------------RPSTSTKRNSFSI 385
            .::.:.|    |||...|.|                      .||.|:..||.||
Human   623 QLSKEKVKEEIGSSWIETPPSIKSLDSNDSGVYTSACKRRRLSPSNSSNENSPSI 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Doc1NP_648283.1 TBOX 58..245 CDD:238106 91/195 (47%)
EOMESNP_001265111.1 TBOX 267..460 CDD:238106 95/206 (46%)
T-box_assoc 482..703 CDD:292794 39/205 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11267
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.