DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doc1 and Tbx10

DIOPT Version :9

Sequence 1:NP_648283.1 Gene:Doc1 / 39039 FlyBaseID:FBgn0028789 Length:391 Species:Drosophila melanogaster
Sequence 2:XP_006230983.1 Gene:Tbx10 / 688822 RGDID:1584144 Length:344 Species:Rattus norvegicus


Alignment Length:361 Identity:134/361 - (37%)
Similarity:190/361 - (52%) Gaps:89/361 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PSRPTLPGVEAKLENNDLWQQFHKIGTEMIITKSGRRMFPSMRVSLSGLEEEASYCVLLEMVPIG 115
            |..|.:..|..:||...||::|:::|||||:||:||||||:.:|.:.|::..|.|.:|::.:|:.
  Rat    16 PKNPRVSSVMVQLEMKPLWEEFNQLGTEMIVTKAGRRMFPTFQVKIVGMDTLADYALLMDFIPLD 80

  Fly   116 DCRYK--FSGSQWVPAGGAEPQSPQRMYLHPDSPATGAHWQSQALLFNKVKLTNNTLDSSGHIVL 178
            |.||:  |..|.|:.||.|:|.:|.|::.||||||.||.|..|.:.|:|:|||||.:|.:|||:|
  Rat    81 DKRYRYAFHSSAWLVAGKADPATPGRVHFHPDSPAKGAQWMRQIVSFDKLKLTNNLMDDNGHIIL 145

  Fly   179 ASMHKYQPRLHII------RSSELTQLPWAPQQAFVFPETEFVAVTAYQNDRITKLKIDNNPFAK 237
            .|||:||||.|::      .|:...|..:   ::|||.||:|.|||||||.|||:|||.:|||||
  Rat   146 NSMHRYQPRFHVVFVDPRKDSARYAQENF---KSFVFMETQFTAVTAYQNHRITQLKIASNPFAK 207

  Fly   238 GFRESGQ-----------SRCKRKLNSSGNSTLESEDDGSSVSSCDSPQAKRQRQDFEQDSTGSV 291
            ||||:..           |...|..:|.|...|:    ||         |:|     |:|::|: 
  Rat   208 GFREADPDSWPATPRPLLSIPARSRSSLGPCLLK----GS---------AER-----EKDTSGT- 253

  Fly   292 SPAYYGATHPVANPMSPYLRHHLSYGPSGAAGLPPSIAAAYFGGVPPQILPMP-----PATYAP- 350
                     ..:.|.:|...||                         |:||.|     ||||.| 
  Rat   254 ---------SASRPRTPTQTHH-------------------------QLLPAPDVLLAPATYRPL 284

  Fly   351 ---TVAPVSPVASQPVGSSTPTTS--PRPSTSTKRN 381
               .:.|.||   ...|:|....:  |.|:.||..|
  Rat   285 PYQNLYPGSP---SHAGTSRARLAPYPLPNISTAGN 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Doc1NP_648283.1 TBOX 58..245 CDD:238106 97/205 (47%)
Tbx10XP_006230983.1 T-box_TBX1_10-like 24..211 CDD:410313 95/189 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11267
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.