DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doc1 and tbx20

DIOPT Version :9

Sequence 1:NP_648283.1 Gene:Doc1 / 39039 FlyBaseID:FBgn0028789 Length:391 Species:Drosophila melanogaster
Sequence 2:XP_021322421.1 Gene:tbx20 / 57936 ZFINID:ZDB-GENE-000427-7 Length:447 Species:Danio rerio


Alignment Length:343 Identity:136/343 - (39%)
Similarity:185/343 - (53%) Gaps:50/343 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PSRPTLPGVEAK--------LENNDLWQQFHKIGTEMIITKSGRRMFPSMRVSLSGLEEEASYCV 107
            |..||.|||.::        ||..:||.:||::|||||||||||||||::|||.||::.:|.|.|
Zfish    83 PLIPTTPGVPSEEMAKISCSLETKELWDKFHELGTEMIITKSGRRMFPTIRVSFSGVDPDAKYIV 147

  Fly   108 LLEMVPIGDCRYKFS--GSQWVPAGGAEPQSPQRMYLHPDSPATGAHWQSQALLFNKVKLTNNTL 170
            |:::||:.:.||:::  .|.|:.||.|:|..|.|:|:|||||.||.....|.:.|.|||||||.|
Zfish   148 LMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLLKQMVSFEKVKLTNNEL 212

  Fly   171 DSSGHIVLASMHKYQPRLHIIR----SSELTQLPWAPQQAFVFPETEFVAVTAYQNDRITKLKID 231
            |..|||:|.||||||||:|||:    ::.|..|.....:.|||.||.|.|||||||..||:||||
Zfish   213 DQHGHIILNSMHKYQPRVHIIKKKDHTASLLNLKSEEFRTFVFTETVFTAVTAYQNQLITRLKID 277

  Fly   232 NNPFAKGFRESGQ-------------------SRCKRKLNSSGNSTLESEDDGSSVSSCDSPQAK 277
            :||||||||:|.:                   :|...:..:....||..|  |.|..|..|  |.
Zfish   278 SNPFAKGFRDSSRLTDIESRESVESLIHKHSYARSPIRTYAGDEETLGEE--GHSAHSRGS--AF 338

  Fly   278 RQRQDFEQDSTGSVSPAYYGATHPVANPMSPYLRHHLSYGPSGAAGLPPSIAAAYFGGVPPQI-- 340
            ....:....|..:.:..:.|..||          ..||...:..|.|...:.....|.:||..  
Zfish   339 TASDNLSLSSWVTTTSGFSGFQHP----------QSLSAIGTSTASLASPLPHPIQGSLPPYSRL 393

  Fly   341 -LPMPPATYAPTVAPVSP 357
             :|:.|:..|.::....|
Zfish   394 GMPLTPSALASSMQATGP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Doc1NP_648283.1 TBOX 58..245 CDD:238106 108/219 (49%)
tbx20XP_021322421.1 T-box 101..287 CDD:307177 104/185 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.