DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doc1 and Tbx21

DIOPT Version :9

Sequence 1:NP_648283.1 Gene:Doc1 / 39039 FlyBaseID:FBgn0028789 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_062380.2 Gene:Tbx21 / 57765 MGIID:1888984 Length:530 Species:Mus musculus


Alignment Length:410 Identity:144/410 - (35%)
Similarity:192/410 - (46%) Gaps:76/410 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PDPFPSMLPFNMPHQQPHMMLPSRPTLPG-VEAKLENNDLWQQFHKIGTEMIITKSGRRMFPSMR 93
            |||...:.|  .|.:.  ..||:...:.| :...|.|:.||.:|::..|||||||.||||||.:.
Mouse   110 PDPRAGLYP--GPRED--YALPAGLEVSGKLRVALSNHLLWSKFNQHQTEMIITKQGRRMFPFLS 170

  Fly    94 VSLSGLEEEASYCVLLEMVPIGDCRYKFSGSQWVPAGGAEPQSP-QRMYLHPDSPATGAHWQSQA 157
            .:::|||..:.|.:.:::|.:....:::...:||..|.||...| .|:|:|||||.|||||..|.
Mouse   171 FTVAGLEPTSHYRMFVDVVLVDQHHWRYQSGKWVQCGKAEGSMPGNRLYVHPDSPNTGAHWMRQE 235

  Fly   158 LLFNKVKLTNNTLDSSG---HIVLASMHKYQPRLHIIRSSELTQLPWAPQQA--------FVFPE 211
            :.|.|:|||||...|:.   .|||.|:|||||||||:..::     ..|:.|        |.|.|
Mouse   236 VSFGKLKLTNNKGASNNVTQMIVLQSLHKYQPRLHIVEVND-----GEPEAACSASNTHVFTFQE 295

  Fly   212 TEFVAVTAYQNDRITKLKIDNNPFAKGFRESGQSRCKRKLNS-----SGNSTLESEDDGSSVSSC 271
            |:|:|||||||..||:||||||||||||||:.:|.......|     ..|..|...|..|.:.|.
Mouse   296 TQFIAVTAYQNAEITQLKIDNNPFAKGFRENFESMYASVDTSVPSPPGPNCQLLGGDPFSPLLSN 360

  Fly   272 DSPQAKRQRQDFEQDSTGSVSPAYYGAT---H----------------PVA-NPMSPYLRHHLSY 316
            ..|...|...|........:|..|:..|   |                |.| .|..||.|.....
Mouse   361 QYPVPSRFYPDLPGQPKDMISQPYWLGTPREHSYEAEFRAVSMKPTLLPSAPGPTVPYYRGQDVL 425

  Fly   317 GPSG----AAGLPPSIA-AAYFGGVPPQILPMPPATYAPTVAPVSPVASQPVGSS------TPTT 370
            .|..    |...||.:: |.:|.  |.:.|||.|..          .:|:..|||      ..:.
Mouse   426 APGAGWPVAPQYPPKMSPAGWFR--PMRTLPMDPGL----------GSSEEQGSSPSLWPEVTSL 478

  Fly   371 SPRPSTS------TKRNSFS 384
            .|.||.|      |||...|
Mouse   479 QPEPSDSGLGEGDTKRRRIS 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Doc1NP_648283.1 TBOX 58..245 CDD:238106 94/199 (47%)
Tbx21NP_062380.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
T-box 138..325 CDD:279278 91/191 (48%)
T-box_assoc <393..520 CDD:292794 29/118 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 444..530 19/67 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831502
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11267
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.