Sequence 1: | NP_648283.1 | Gene: | Doc1 / 39039 | FlyBaseID: | FBgn0028789 | Length: | 391 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001095140.2 | Gene: | tbx3a / 556870 | ZFINID: | ZDB-GENE-070209-80 | Length: | 689 | Species: | Danio rerio |
Alignment Length: | 596 | Identity: | 177/596 - (29%) |
---|---|---|---|
Similarity: | 244/596 - (40%) | Gaps: | 235/596 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 IMQRIPDPFPSMLPF-NMPHQQPHMMLPSRPTLPGVEAK------LENNDLWQQFHKIGTEMIIT 82
Fly 83 KSGRRMFPSMRVSLSGLEEEASYCVLLEMVPIGDCRYKFSGSQWVPAGGAEPQSPQRMYLHPDSP 147
Fly 148 ATGAHWQSQALLFNKVKLTNNTLDSSGHIVLASMHKYQPRLHIIRSSELTQLPWAPQQAFVFPET 212
Fly 213 EFVAVTAYQNDRITKLKIDNNPFAKGFRESGQSR------------------------------- 246
Fly 247 ------CKRKLNSSGNSTL---------------ESED---------DGSSVSS----------- 270
Fly 271 --------CDSPQAKRQ---RQDFEQ--------------------------DSTGSVSPAYY-- 296
Fly 297 ------GATHPVANPM---------------------SPYLRHHLSYGPSG-----AAGLPPSIA 329
Fly 330 AAYFGGV----------PPQIL---PMP------------------------PATYAPTVAPVSP 357
Fly 358 VAS------------------------------------QPVGSS-----------TPTTSPRPS 375
Fly 376 TSTKRNSFSIS 386 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Doc1 | NP_648283.1 | TBOX | 58..245 | CDD:238106 | 107/192 (56%) |
tbx3a | NP_001095140.2 | TBOX | 99..282 | CDD:238106 | 105/182 (58%) |
TBX | 298..385 | CDD:204975 | 10/86 (12%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3585 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2837 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |