Sequence 1: | NP_648283.1 | Gene: | Doc1 / 39039 | FlyBaseID: | FBgn0028789 | Length: | 391 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001300611.1 | Gene: | tbx5a / 30071 | ZFINID: | ZDB-GENE-991124-7 | Length: | 492 | Species: | Danio rerio |
Alignment Length: | 422 | Identity: | 150/422 - (35%) |
---|---|---|---|
Similarity: | 209/422 - (49%) | Gaps: | 113/422 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 PSRPT------LPGVEAKLENNDLWQQFHKIGTEMIITKSGRRMFPSMRVSLSGLEEEASYCVLL 109
Fly 110 EMVPIGDCRYKFSGSQWVPAGGAEPQSPQRMYLHPDSPATGAHWQSQALLFNKVKLTNNTLDSSG 174
Fly 175 HIVLASMHKYQPRLHIIRSSELTQLPWAPQQAF---VFPETEFVAVTAYQNDRITKLKIDNNPFA 236
Fly 237 KGFRESG--------------------QSRCKRKLNSSGNSTLESEDDGSSVS-------SCDS- 273
Fly 274 ---------PQA-------------KRQRQD--------FEQ---DSTGSVSPAYYGATHPVANP 305
Fly 306 MSPYLRHHLSYGPSGA-------AGLP------PSIAAAYFGGVPPQILP--------------- 342
Fly 343 ----MPPA--TYAPTV----APVSPVASQPVG 364 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Doc1 | NP_648283.1 | TBOX | 58..245 | CDD:238106 | 106/209 (51%) |
tbx5a | NP_001300611.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..43 | 2/3 (67%) | |
TBOX | 52..240 | CDD:238106 | 106/188 (56%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 331..352 | 2/20 (10%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3585 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11267 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |