DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doc1 and MGA

DIOPT Version :9

Sequence 1:NP_648283.1 Gene:Doc1 / 39039 FlyBaseID:FBgn0028789 Length:391 Species:Drosophila melanogaster
Sequence 2:XP_005254300.1 Gene:MGA / 23269 HGNCID:14010 Length:3115 Species:Homo sapiens


Alignment Length:251 Identity:107/251 - (42%)
Similarity:156/251 - (62%) Gaps:6/251 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LPSRPTLPGVEAKLENNDLWQQFHKIGTEMIITKSGRRMFPSMRVSLSGLEEEASYCVLLEMVPI 114
            ||:..|:.|:...|:||.:|.:|:...||||:||.||||||..|..::||:....|.:::::.|:
Human    66 LPADCTVGGITVTLDNNSMWNEFYHRSTEMILTKQGRRMFPYCRYWITGLDSNLKYILVMDISPV 130

  Fly   115 GDCRYKFSGSQWVPAGGAEPQSPQRMYLHPDSPATGAHWQSQALLFNKVKLTNNTLDSSGHIVLA 179
            .:.|||::|..|.|:|.|||....|:::||:||:||.:|..|.:.|.|:||||||||..|||:|.
Human   131 DNHRYKWNGRWWEPSGKAEPHVLGRVFIHPESPSTGHYWMHQPVSFYKLKLTNNTLDQEGHIILH 195

  Fly   180 SMHKYQPRLHII---RSSELTQLPWAPQQAFVFPETEFVAVTAYQNDRITKLKIDNNPFAKGFRE 241
            |||:|.||||::   ::.|:.||.......|.||:|||.|||||||.:||:||||.||||||||:
Human   196 SMHRYLPRLHLVPAEKAVEVIQLNGPGVHTFTFPQTEFFAVTAYQNIQITQLKIDYNPFAKGFRD 260

  Fly   242 SGQSRCKRKLNSSGNSTLESEDDGSSVSSCDSPQAKRQRQDFEQDSTGSVSPAYYG 297
            .|   ...|....|.....|:.:|:::||....:.:.......:...|.:.|...|
Human   261 DG---LNNKPQRDGKQKNSSDQEGNNISSSSGHRVRLTEGQGSEIQPGDLDPLSRG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Doc1NP_648283.1 TBOX 58..245 CDD:238106 95/189 (50%)
MGAXP_005254300.1 TBOX 74..264 CDD:238106 95/192 (49%)
DUF4801 1041..1087 CDD:292677
HLH 2475..2525 CDD:278439
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11267
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.