DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doc1 and Tbx1

DIOPT Version :9

Sequence 1:NP_648283.1 Gene:Doc1 / 39039 FlyBaseID:FBgn0028789 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001360867.1 Gene:Tbx1 / 21380 MGIID:98493 Length:529 Species:Mus musculus


Alignment Length:361 Identity:140/361 - (38%)
Similarity:191/361 - (52%) Gaps:70/361 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PTLPGVEAKLENNDLWQQFHKIGTEMIITKSGRRMFPSMRVSLSGLEEEASYCVLLEMVPIGDCR 118
            |.:..|..:||...||.:|:::|||||:||:||||||:.:|.|.|::..|.|.:|::.||:.|.|
Mouse   144 PKVASVSVQLEMKALWDEFNQLGTEMIVTKAGRRMFPTFQVKLFGMDPMADYMLLMDFVPVDDKR 208

  Fly   119 YK--FSGSQWVPAGGAEPQSPQRMYLHPDSPATGAHWQSQALLFNKVKLTNNTLDSSGHIVLASM 181
            |:  |..|.|:.||.|:|.:|.|::.||||||.||.|..|.:.|:|:|||||.||.:|||:|.||
Mouse   209 YRYAFHSSSWLVAGKADPATPGRVHYHPDSPAKGAQWMKQIVSFDKLKLTNNLLDDNGHIILNSM 273

  Fly   182 HKYQPRLHII-----RSSELTQLPWAPQ--QAFVFPETEFVAVTAYQNDRITKLKIDNNPFAKGF 239
            |:||||.|::     :.||    .:|.:  :.|||.||.|.|||||||.|||:|||.:|||||||
Mouse   274 HRYQPRFHVVYVDPRKDSE----KYAEENFKTFVFEETRFTAVTAYQNHRITQLKIASNPFAKGF 334

  Fly   240 RESGQ---------------SRCKRKLNSSGNSTLESEDDGSSVSSCDSPQAKRQRQDFEQDSTG 289
            |:...               |...|..|...:.|   :.:||...:.::      |::|::||  
Mouse   335 RDCDPEDWPRNHRPGALPLVSAFARSRNPVASPT---QPNGSDKDAAEA------RREFDRDS-- 388

  Fly   290 SVSPAYYG-ATHP---VANPMSPYLRHHLSYGPSGAAGLPPSIAAAYFGG-----VPPQI---LP 342
              .||..| ||||   :|..:||.|.     ||.|...||        ||     .||..   |.
Mouse   389 --GPAALGDATHPPQLLARVLSPALP-----GPGGLVPLP--------GGSGGRHSPPHADLRLE 438

  Fly   343 MP----PATYAPTVAPVSPVASQPVGSSTPTTSPRP 374
            .|    |..:.|...|.:.........|.|...|.|
Mouse   439 APGASEPLHHHPYKYPAAAYDHYLGAKSRPAPYPLP 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Doc1NP_648283.1 TBOX 58..245 CDD:238106 100/210 (48%)
Tbx1NP_001360867.1 T-box 151..336 CDD:366363 98/188 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11267
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2837
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.