DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doc1 and tbx-32

DIOPT Version :9

Sequence 1:NP_648283.1 Gene:Doc1 / 39039 FlyBaseID:FBgn0028789 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_508304.2 Gene:tbx-32 / 191303 WormBaseID:WBGene00006551 Length:441 Species:Caenorhabditis elegans


Alignment Length:229 Identity:51/229 - (22%)
Similarity:88/229 - (38%) Gaps:53/229 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 EMIITKSGR-RMFPSMRVSLSGLEEEASYCVLLEMVPIGDCRYKFSGS----QWVPAGGAE-PQS 136
            |.::||..: .:...:..:|.||.....|.:.:::..|.:.:|||:|:    .:.|...:| |..
 Worm    32 EQMLTKRKKTNISQDLHYTLLGLNPRDLYQISIKLARIDEKKYKFNGNFNGGDYYPHKNSEIPME 96

  Fly   137 PQRMYLHPDSPATGAHWQSQALLFNKVKLTNNTLDSSGHIVLASMHKYQPRLHIIRSSELTQLPW 201
            .....:|.|...|||.|....:.|.|:.::....|....::|.|:|.|.|.|....||.::    
 Worm    97 DTEEIVHLDGYQTGARWMKTGVYFPKIGISKEQPDKERCLLLESLHAYVPVLRFTTSSGIS---- 157

  Fly   202 APQQAFVFPETEFVAVTAYQNDRITKLKIDNNPFAKGFRESGQSRCKRKLNSSGNSTLESEDDGS 266
                         :.||.:....:|.:...|        .|.:.|.||||..:            
 Worm   158 -------------LEVTVWSQKFVTTMTSSN--------RSVKRREKRKLEET------------ 189

  Fly   267 SVSSCDSPQAKRQRQ--DFEQDSTGSVSPAYYGA 298
                 ..|.||:..:  :|.|:   :|.|..|.|
 Worm   190 -----TGPSAKKTPEVIEFTQE---AVVPEVYNA 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Doc1NP_648283.1 TBOX 58..245 CDD:238106 37/172 (22%)
tbx-32NP_508304.2 TBOX 15..200 CDD:214656 45/209 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11267
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.