DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doc1 and Eomes

DIOPT Version :9

Sequence 1:NP_648283.1 Gene:Doc1 / 39039 FlyBaseID:FBgn0028789 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_034266.2 Gene:Eomes / 13813 MGIID:1201683 Length:707 Species:Mus musculus


Alignment Length:439 Identity:139/439 - (31%)
Similarity:192/439 - (43%) Gaps:135/439 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 HMMLPSRPTLPGVEAKLENNDLWQQFHKIGTEMIITKSGRRMFPSMRVSLSGLEEEASYCVLLEM 111
            |:.|.:||             ||.:||:..|||||||.||||||.:..:::||...|.|.|.:|:
Mouse   270 HVYLCNRP-------------LWLKFHRHQTEMIITKQGRRMFPFLSFNINGLNPTAHYNVFVEV 321

  Fly   112 VPIGDCRYKFSGSQWVPAGGAE-PQSPQRMYLHPDSPATGAHWQSQALLFNKVKLTNN---TLDS 172
            |......::|.|.:||..|.|: .....:||:||:||.||:||..|.:.|.|:|||||   ..::
Mouse   322 VLADPNHWRFQGGKWVTCGKADNNMQGNKMYVHPESPNTGSHWMRQEISFGKLKLTNNKGANNNN 386

  Fly   173 SGHIVLASMHKYQPRLHIIRSSE-----LTQLPWAPQQAFVFPETEFVAVTAYQNDRITKLKIDN 232
            :..|||.|:|||||||||:..:|     |.: | :..|.|.|.||:|:|||||||..||:||||:
Mouse   387 TQMIVLQSLHKYQPRLHIVEVTEDGVEDLNE-P-SKTQTFTFSETQFIAVTAYQNTDITQLKIDH 449

  Fly   233 NPFAKGFRESGQSRCKRKLNSSGNSTLESEDDGSSVSSCDSPQAKR------------------- 278
            ||||||||::..|           ....||:|..:.|..|||::.:                   
Mouse   450 NPFAKGFRDNYDS-----------MYTASENDRLTPSPTDSPRSHQIVPGGRYGVQNFFPEPFVN 503

  Fly   279 ---QRQDFEQDST-----GSVSPAYYGATHPVANPMSPYL--------RHHLSYG---------- 317
               |.:.:..:.|     |.:||.   .:..||||...:|        .:.|..|          
Mouse   504 TLPQARYYNGERTVPQTNGLLSPQ---QSEEVANPPQRWLVTPVQQPVTNKLDIGSYESEYTSST 565

  Fly   318 --PSGAAGLP--PSIAAAYFGGVPPQILP------------------MP-PATYAPTVAPVSPVA 359
              |.|...||  .|.|..|:   |....|                  :| .:..:|.|.|...:|
Mouse   566 LLPYGIKSLPLQTSHALGYY---PDPTFPAMAGWGGRGAYQRKMAAGLPWTSRMSPPVFPEDQLA 627

  Fly   360 SQPV----GSSTPTTSP----------------------RPSTSTKRNS 382
            .:.|    .||...|.|                      .|||.:..||
Mouse   628 KEKVKEEISSSWIETPPSIKSLDSSDSGVYNSACKRKRLSPSTPSNGNS 676

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Doc1NP_648283.1 TBOX 58..245 CDD:238106 91/195 (47%)
EomesNP_034266.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..125
TBOX 269..462 CDD:238106 95/206 (46%)
T-box_assoc 484..705 CDD:292794 36/199 (18%)
Required for transcription activation. /evidence=ECO:0000250 592..707 15/85 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 642..689 7/35 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11267
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.