DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doc2 and Tbx10

DIOPT Version :9

Sequence 1:NP_648282.1 Gene:Doc2 / 39038 FlyBaseID:FBgn0035956 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_006230983.1 Gene:Tbx10 / 688822 RGDID:1584144 Length:344 Species:Rattus norvegicus


Alignment Length:392 Identity:136/392 - (34%)
Similarity:193/392 - (49%) Gaps:90/392 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PRVTLPGVEMTLQNDDLWKQFHQIGTEMIITKSGRRMFPSMRLSVSGLEDESNYCVLLEMVPIGD 113
            |||:  .|.:.|:...||::|:|:|||||:||:||||||:.::.:.|::..::|.:|::.:|:.|
  Rat    19 PRVS--SVMVQLEMKPLWEEFNQLGTEMIVTKAGRRMFPTFQVKIVGMDTLADYALLMDFIPLDD 81

  Fly   114 CRYK--FSGSQWVPAGGAEPQSPQRMYLHPDSPATGAHWQAQPILFNKVKLTNNTLDNSGHIVLA 176
            .||:  |..|.|:.||.|:|.:|.|::.||||||.||.|..|.:.|:|:|||||.:|::|||:|.
  Rat    82 KRYRYAFHSSAWLVAGKADPATPGRVHFHPDSPAKGAQWMRQIVSFDKLKLTNNLMDDNGHIILN 146

  Fly   177 SMHKYQPRLHVI---RTADLAQIPWAPQQAFVFAETEFVAVTAYQNDRITKLKIDNNPFAKGFRE 238
            |||:||||.||:   ...|.|:......::|||.||:|.|||||||.|||:|||.:|||||||||
  Rat   147 SMHRYQPRFHVVFVDPRKDSARYAQENFKSFVFMETQFTAVTAYQNHRITQLKIASNPFAKGFRE 211

  Fly   239 TGQSRCKRKMSSSPTGEDQDQSPS----LSHSQSQSESDMSPTKGGGETAGGTSSIGDSDGPQIK 299
            .                |.|..|:    |....::|.|.:.|                       
  Rat   212 A----------------DPDSWPATPRPLLSIPARSRSSLGP----------------------- 237

  Fly   300 RLRSNGSACSLSSSLDDQSVPGASSLALGSPPPHLHSHSHPHPLQARSASSVFMQHFQQNMQSLL 364
                    |.|..|.:.:.....:|.:....|...|....|.|                  ..||
  Rat   238 --------CLLKGSAEREKDTSGTSASRPRTPTQTHHQLLPAP------------------DVLL 276

  Fly   365 RPSLVDLACTYFGRPHEYGGAIQASPMYPPAAMLQAGLGPHPGLNLPPGVSGADLISDESGAEEL 429
            .|:      ||  ||..|......||.:  |...:|.|.|:|    .|.:|.|....|.:.|..|
  Rat   277 APA------TY--RPLPYQNLYPGSPSH--AGTSRARLAPYP----LPNISTAGNQEDPTFAAGL 327

  Fly   430 EL 431
            .|
  Rat   328 GL 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Doc2NP_648282.1 TBOX 55..242 CDD:238106 96/191 (50%)
Tbx10XP_006230983.1 T-box_TBX1_10-like 24..211 CDD:410313 94/186 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11267
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.