DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doc2 and tbx-41

DIOPT Version :9

Sequence 1:NP_648282.1 Gene:Doc2 / 39038 FlyBaseID:FBgn0035956 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_508343.2 Gene:tbx-41 / 188917 WormBaseID:WBGene00006560 Length:156 Species:Caenorhabditis elegans


Alignment Length:66 Identity:16/66 - (24%)
Similarity:29/66 - (43%) Gaps:15/66 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 HKYQP-RLHVIRTADLAQIPWAPQQAFVFAETEFVAVTAYQNDRITKLKIDNNPFAKGFRETGQS 242
            |..|| .:|.:.:   .::|:.           |:.||.|:|.....||:..||.|:.|.:...:
 Worm    23 HMQQPATMHRVSS---CRLPYT-----------FMTVTMYKNREARVLKLGMNPHARHFLKNNTN 73

  Fly   243 R 243
            :
 Worm    74 K 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Doc2NP_648282.1 TBOX 55..242 CDD:238106 16/63 (25%)
tbx-41NP_508343.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.