powered by:
Protein Alignment Doc2 and tbx-41
DIOPT Version :9
Sequence 1: | NP_648282.1 |
Gene: | Doc2 / 39038 |
FlyBaseID: | FBgn0035956 |
Length: | 469 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_508343.2 |
Gene: | tbx-41 / 188917 |
WormBaseID: | WBGene00006560 |
Length: | 156 |
Species: | Caenorhabditis elegans |
Alignment Length: | 66 |
Identity: | 16/66 - (24%) |
Similarity: | 29/66 - (43%) |
Gaps: | 15/66 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 179 HKYQP-RLHVIRTADLAQIPWAPQQAFVFAETEFVAVTAYQNDRITKLKIDNNPFAKGFRETGQS 242
|..|| .:|.:.: .::|:. |:.||.|:|.....||:..||.|:.|.:...:
Worm 23 HMQQPATMHRVSS---CRLPYT-----------FMTVTMYKNREARVLKLGMNPHARHFLKNNTN 73
Fly 243 R 243
:
Worm 74 K 74
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Doc2 | NP_648282.1 |
TBOX |
55..242 |
CDD:238106 |
16/63 (25%) |
tbx-41 | NP_508343.2 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3585 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.