DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doc3 and mgaa

DIOPT Version :9

Sequence 1:NP_648280.1 Gene:Doc3 / 39036 FlyBaseID:FBgn0035954 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_005158676.1 Gene:mgaa / 569620 ZFINID:ZDB-GENE-030603-1 Length:2838 Species:Danio rerio


Alignment Length:224 Identity:102/224 - (45%)
Similarity:135/224 - (60%) Gaps:17/224 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PQPTLPGDVEAK-----LENNELWQQFHSIGTEMIITKCGRRMFPSMRVSLSGLEEEASYCVLLE 110
            |...||.|...:     |:||.:|.:||...||||:||.||||||..|..|||:|...:|.:.::
Zfish    87 PSENLPADARCRGITVTLDNNNMWNEFHRCKTEMILTKQGRRMFPYCRFRLSGMEPFQNYVLAMD 151

  Fly   111 MVPIGDCRYKFSGSQWVPAGGAEPQSPQRMYLHPESPATGKHWQSQALLFSKVKLTNNTLDNNGH 175
            :.|..:||||:||..|.|.|.|||.. .|:::||||||:|.||....:.|.::||. ||||..||
Zfish   152 IKPADNCRYKWSGKGWEPNGKAEPHI-SRLFVHPESPASGLHWMQYPVSFYRLKLC-NTLDQEGH 214

  Fly   176 IVLASMHKYQPRLHVIRTSDLGQ---IPWAPQQAFI-FPETEFIAVTAYQNDRITKLKIDNNPFA 236
            |:|.|||:|.|::|:|....:.:   |...|....: |.:|||.|||||||..||:||||.||||
Zfish   215 IILHSMHRYLPQIHIIPADKVSKDILILDRPNVVTLSFAQTEFFAVTAYQNLCITQLKIDYNPFA 279

  Fly   237 KGFRESG----QSRCKRKINDSPPPTQPE 261
            |||||..    .|:.|..:  |...|:.|
Zfish   280 KGFREDAVNARSSKAKNGL--STDETESE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Doc3NP_648280.1 TBOX 58..245 CDD:238106 94/199 (47%)
mgaaXP_005158676.1 T-box 102..284 CDD:279278 91/183 (50%)
DUF4801 1321..1366 CDD:292677
NTR2 <2131..2271 CDD:292097
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11267
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.