DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Doc3 and Tbx4

DIOPT Version :10

Sequence 1:NP_648280.1 Gene:Doc3 / 39036 FlyBaseID:FBgn0035954 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_035666.2 Gene:Tbx4 / 21387 MGIID:102556 Length:552 Species:Mus musculus


Alignment Length:92 Identity:18/92 - (19%)
Similarity:38/92 - (41%) Gaps:12/92 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 VIKDGVSVERNKLFSEWVRECVELLELLGIPVLKANGEAEALCAQLNSQGFVDACITP-DSDAFL 166
            |.|||::......:........|.|...|:.:.:.|.||:||..:...:.|:.:.:.. ......
Mouse   791 VWKDGLAFRVEVAYHREPHILRESLTPEGMLIYRDNAEAQALELETQHKPFLTSTLHGLQQQHGC 855

  Fly   167 FGAMC-----------VIKDIKPNSRE 182
            |||:|           :::|::..:.:
Mouse   856 FGAVCRLAKRWLASQFLLEDVREEAAD 882

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Doc3NP_648280.1 T-box_Drosocross-like 59..241 CDD:410332 18/92 (20%)
Tbx4NP_035666.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
T-box_TBX4_5-like 72..256 CDD:410315
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.